Active Recombinant Rat Epo protein, His-tagged

Cat.No. : Epo-01R
Product Overview : Recombinant rat Erythropoietin/EPO Protein (27-192aa), fused to His-tag at C-terminus, was expressed in HEK293 cell and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : HEK293
Tag : His
Protein Length : 27-192 a.a.
Description : Acts as a regulator of erythropoiesis; may facilitate oxygen delivery in response to hypoxia
Form : Liquid
Bio-activity : Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 range ≤ 2 ng/mL.
Molecular Mass : 19.6 kDa
AA Sequence : APPRLICDSRVLERYILEAKEAENVTMGCAEGPRLSENITVPDTKVNFYAWKRMKVEEQAVEVWQGLSLLSEAILQAQALQANSSQPPESLQLHIDKAISGLRSLTSLLRVLGAQKELMSPPDATQAAPLRTLTADTFCKLFRVYSNFLRGKLKLYTGEACRRGDR
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 95% by SDS-PAGE
Applications : SDS-PAGE, Bioactivity
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 1 mg/mL
Storage Buffer : In Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
Gene Name Epo erythropoietin [ Rattus norvegicus (Norway rat) ]
Official Symbol Epo
Synonyms Epo; erythropoietin; erythropoietin
Gene ID 24335
mRNA Refseq NM_017001
Protein Refseq NP_058697
UniProt ID P29676

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Epo Products

Required fields are marked with *

My Review for All Epo Products

Required fields are marked with *

0
cart-icon
0
compare icon