Active Recombinant Rat Epo protein, His-tagged

• Cat.No.: Epo-01R
• Product Overview: Recombinant rat Erythropoietin/EPO Protein (27-192aa), fused to His-tag at C-terminus, was expressed in HEK293 cell and purified by using conventional chromatography techniques.

Specification

• Species: Rat
• Source: HEK293
• Tag: His
• Protein Length: 27-192 a.a.
• Description: Acts as a regulator of erythropoiesis; may facilitate oxygen delivery in response to hypoxia
• Form: Liquid
• Bio-activity: Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 range ≤ 2 ng/mL.
• Molecular Mass: 19.6 kDa
• AA Sequence: APPRLICDSRVLERYILEAKEAENVTMGCAEGPRLSENITVPDTKVNFYAWKRMKVEEQAVEVWQGLSLLSEAILQAQALQANSSQPPESLQLHIDKAISGLRSLTSLLRVLGAQKELMSPPDATQAAPLRTLTADTFCKLFRVYSNFLRGKLKLYTGEACRRGDR
• Endotoxin: < 1 EU/μg of protein (determined by LAL method)
• Purity: > 95% by SDS-PAGE
• Applications: SDS-PAGE, Bioactivity
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 1 mg/mL
• Storage Buffer: In Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol

Gene Information

• Gene Name: Epo erythropoietin [ Rattus norvegicus (Norway rat) ]
• Official Symbol: Epo
• Synonyms: Epo; erythropoietin; erythropoietin
• Gene ID: 24335
• mRNA Refseq: NM_017001
• Protein Refseq: NP_058697
• UniProt ID: P29676