Active Recombinant Rat Igf1 Protein (71 aa)
Cat.No. : | Igf1-374I |
Product Overview : | Recombinant rat Insulin-like Growth Factor I (rrIGF-I) produced in E. coli is a single non-glycosylated polypeptide chain containing 71 amino acids. A fully biologically active molecule, rrIGF-I has a molecular mass of 7.8 kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Protein Length : | 71 |
Description : | Insulin-like Growth Factor I (IGF-I) is a single chain 7 kDa growth-promoting polypeptide originally identified as somatomedin-c. It belongs to the IGF family of peptides, which also includes IGF-II and insulin. The gene expression of IGF-I is mainly regulated by Growth Hormone, and IGF-I executes its functions via signaling through transmembrane tyrosine receptors(IGF Receptors). Most circulating IFG-I is associated with the IGF Binding Protein 3 (IGFBP-3), and the IGFBPs may inhibit the actions of IGFs by competing against the IGF Receptors. IGF-I is active in post-natal and adult animals, and is crucial for somatic growth, as IGF-I null mice show marked retardation in utero. IGF-I is involved in the carcinogenesis, and related to the prostate cancer as well. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 10 ng/mL, measured by a cell proliferation assay using FDCP-1 cells, corresponding to a specific activity of > 1 × 10^5 units/mg. |
Molecular Mass : | 7.8 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | MGPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKSA |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by SDS-PAGE and HPLC. |
Storage : | Lyophilized recombinant rat Insulin-like Growth Factor I (rrIGF-I) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rrIGF-I remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O at 100 μg/mL. |
Gene Name | Igf1 insulin-like growth factor 1 [ Rattus norvegicus ] |
Official Symbol | Igf1 |
Synonyms | IGF1; insulin-like growth factor 1; insulin-like growth factor I; IGF-I; somatomedin; |
Gene ID | 24482 |
mRNA Refseq | NM_001082477 |
Protein Refseq | NP_001075946 |
UniProt ID | P08025 |
◆ Recombinant Proteins | ||
IGF1-4121H | Recombinant Human IGF1 protein, GST-tagged | +Inquiry |
IGF1-137H | Active Recombinant Human IGF1 Protein | +Inquiry |
IGF1-0242H | Active Recombinant Human IGF1 protein, His-Avi-tagged, Biotinylated | +Inquiry |
IGF1-2215R | Recombinant Rhesus monkey IGF1 Protein, His-tagged | +Inquiry |
IGF1-650H | Active Recombinant Human Insulin Like Growth Factor-I, HIgG1 Fc-tagged, mutant | +Inquiry |
◆ Cell & Tissue Lysates | ||
IGF1-5268HCL | Recombinant Human IGF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Igf1 Products
Required fields are marked with *
My Review for All Igf1 Products
Required fields are marked with *
0
Inquiry Basket