Active Recombinant Rat Igf1 Protein (71 aa)

Cat.No. : Igf1-374I
Product Overview : Recombinant rat Insulin-like Growth Factor I (rrIGF-I) produced in E. coli is a single non-glycosylated polypeptide chain containing 71 amino acids. A fully biologically active molecule, rrIGF-I has a molecular mass of 7.8 kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Protein Length : 71
Description : Insulin-like Growth Factor I (IGF-I) is a single chain 7 kDa growth-promoting polypeptide originally identified as somatomedin-c. It belongs to the IGF family of peptides, which also includes IGF-II and insulin. The gene expression of IGF-I is mainly regulated by Growth Hormone, and IGF-I executes its functions via signaling through transmembrane tyrosine receptors(IGF Receptors). Most circulating IFG-I is associated with the IGF Binding Protein 3 (IGFBP-3), and the IGFBPs may inhibit the actions of IGFs by competing against the IGF Receptors. IGF-I is active in post-natal and adult animals, and is crucial for somatic growth, as IGF-I null mice show marked retardation in utero. IGF-I is involved in the carcinogenesis, and related to the prostate cancer as well.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50 < 10 ng/mL, measured by a cell proliferation assay using FDCP-1 cells, corresponding to a specific activity of > 1 × 10^5 units/mg.
Molecular Mass : 7.8 kDa, observed by reducing SDS-PAGE.
AA Sequence : MGPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKSA
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% as analyzed by SDS-PAGE and HPLC.
Storage : Lyophilized recombinant rat Insulin-like Growth Factor I (rrIGF-I) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rrIGF-I remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O at 100 μg/mL.
Gene Name Igf1 insulin-like growth factor 1 [ Rattus norvegicus ]
Official Symbol Igf1
Synonyms IGF1; insulin-like growth factor 1; insulin-like growth factor I; IGF-I; somatomedin;
Gene ID 24482
mRNA Refseq NM_001082477
Protein Refseq NP_001075946
UniProt ID P08025

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Igf1 Products

Required fields are marked with *

My Review for All Igf1 Products

Required fields are marked with *

0
cart-icon