Active Recombinant Rat IL12 protein, His-tagged
Cat.No. : | IL12-27R |
Product Overview : | Recombinant Rat Interleukin-12 is expressed in CHO cells and the target gene encoding Met23-Ser335(p40)&Arg23-Ser215(p35) is expressed with a 6His tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | Mammalian Cells |
Tag : | His |
Protein Length : | 23-335;23-215 a.a. |
Description : | Interleukin-12 (IL-12), also known as NKSF, TCMF, CLMF and TSF, is a heterodimeric cytokine composed of p35 and p40 subunits. It is produced by monocytes, macrophages, B cells and dendritic cells in response to bacterial lipopolysaccharides and intracellular pathogens. IL-12 signals through the IL-12 receptor complex, which is comprised of IL-12 Rβ1 and IL-12 Rβ2. IL-12 induces the proliferation and activation of hematopoietic stem cells, natural killer cells and T- cells. It is indispensible during the development of Th1 cells, leading to the production of IFN-gamma and IL-2. |
Form : | Lyophilized after extensive dialysis against PBS. |
Bio-activity : | ED50< 0.1ng/ml, measured in a cell proliferation assay using 2D6 cells. |
Molecular Mass : | 26-28kDa (p35) and 42-45 kDa (p40), observed by reducing SDS-PAGE. |
AA Sequence : | p35:RVIPVSGPAKCLNQSQNLLKTTDDMVRTAREKLKHYSCTAGDIDHEDITRDKTSTLEACLPLELHKNESCLATKETSSIIRGSCLPPQKTSLMMTLCLGSIYEDLKMYQSEFQAINAALQSHNHQQITLDRNMLMAIDELMRSLNHSGETLHQKAPMGEADPYRVKMKLCILLHAFSTRVMTINRVMNYLSSSHHHHHH p40: MWELEKDVYV VEVDWRPDAP GETVTLTCDS PEEDDITWTS DQRRGVIGSG KTLTITVREF LDAGQYTCHR GGETLSHSHL LLHKKENGIW STEILKNFKNKTFLKCEAPN YSGRFTCSWLVHRNTDLKFNIKSSSSSPESRAVTCGRASLSAEKVTLNQRDYEKYSVACQEDVTCPTAEETLPIELVVEAQQQNKYENYSTSFFIRDIIKPDPPKNLQVKPLKNSQVEVS WEYPDSWSTPHSYFSLKFFVRIQRKKEKTKETEEECNQKGAFLVEKTSAEVQCKGANICVQAQDRYYNSSCSKWTCVPCRGRS |
Endotoxin : | <0.2 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by SDS-PAGE. |
Storage : | Lyophilized recombinant rat Interleukin-12 (IL-12), His remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rat Interleukin-12 (IL-12), His should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/ml. |
Gene Name | interleukin 12A [ Rattus norvegicus ] |
Official Symbol | IL12A |
Synonyms | Interleukin-12; IL-12; IL12A |
Gene ID | 84405 |
mRNA Refseq | NM_053390.1 |
Protein Refseq | NP_445842.1 |
UniProt ID | Q9R103 |
◆ Recombinant Proteins | ||
IL12-27R | Active Recombinant Rat IL12 protein, His-tagged | +Inquiry |
IL12-002H | Active Recombinant Human IL12, HIgG1 Fc-tagged, mutant | +Inquiry |
Il12-3765M | Recombinant Mouse Il12 Protein (Arg23-Ala215, Met23-Ser335), C-His and Strep tagged | +Inquiry |
Il12b-175M | Active Recombinant Mouse interleukin 12 Protein, Flag tagged | +Inquiry |
IL12-12H | Recombinant Human IL12 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL12 Products
Required fields are marked with *
My Review for All IL12 Products
Required fields are marked with *