Active Recombinant Rat Il1a Protein

Cat.No. : Il1a-251I
Product Overview : Recombinant Rat Il1a Protein without tag was expressed in CHO.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : CHO
Description : Interleukin-1 alpha (IL-1α), is produced in a variety of cells including monocytes, tissue macrophages, keratinocytes and other epithelial cells. Both IL-1alpha and IL-1beta bind to the same receptor and have similar if not identical biological properties. These cytokines have a broad range of activities including stimulation of thymocyte proliferation via IL-2 release, B-cell maturation and proliferation, mitogenic FGF-like activity, and the ability to stimulate the release of prostaglandin and collagenase from synovial cells. However, whereas IL-1beta is a secreted cytokine, IL-1alpha is predominantly a cell-associated cytokine.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50 < 5 pg/mL, measured in a proliferation assay using D10S cells.
Molecular Mass : 17~22 kDa, observed by reducing SDS-PAGE.
AA Sequence : APHSFQNNLRYKLIRIVKQEFIMNDSLNQNIYVDMDRIHLKAASLNDLQLEVKFDMYAYSSGGDDSKYPVTLKVSNTQLFVSAQGEDKPVLLKEIPETPKLITGSETDLIFFWEKINSKNYFTSAAFPELLIATKEQSQVHLARGLPSMIDFQIS
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% as analyzed by SDS-PAGE.
Storage : Lyophilized recombinant Rat Interleukin-1 alpha remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Rat Interleukin-1 alpha should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O or PBS at 100 μg/mL.
Gene Name Il1a interleukin 1 alpha [ Rattus norvegicus ]
Official Symbol Il1a
Synonyms IL1A; interleukin 1 alpha; interleukin-1 alpha; IL-1 alpha;
Gene ID 24493
mRNA Refseq NM_017019
Protein Refseq NP_058715
UniProt ID P16598

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Il1a Products

Required fields are marked with *

My Review for All Il1a Products

Required fields are marked with *

0
cart-icon
0
compare icon