Active Recombinant Rat Il1a Protein
Cat.No. : | Il1a-251I |
Product Overview : | Recombinant Rat Il1a Protein without tag was expressed in CHO. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | CHO |
Description : | Interleukin-1 alpha (IL-1α), is produced in a variety of cells including monocytes, tissue macrophages, keratinocytes and other epithelial cells. Both IL-1alpha and IL-1beta bind to the same receptor and have similar if not identical biological properties. These cytokines have a broad range of activities including stimulation of thymocyte proliferation via IL-2 release, B-cell maturation and proliferation, mitogenic FGF-like activity, and the ability to stimulate the release of prostaglandin and collagenase from synovial cells. However, whereas IL-1beta is a secreted cytokine, IL-1alpha is predominantly a cell-associated cytokine. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 5 pg/mL, measured in a proliferation assay using D10S cells. |
Molecular Mass : | 17~22 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | APHSFQNNLRYKLIRIVKQEFIMNDSLNQNIYVDMDRIHLKAASLNDLQLEVKFDMYAYSSGGDDSKYPVTLKVSNTQLFVSAQGEDKPVLLKEIPETPKLITGSETDLIFFWEKINSKNYFTSAAFPELLIATKEQSQVHLARGLPSMIDFQIS |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by SDS-PAGE. |
Storage : | Lyophilized recombinant Rat Interleukin-1 alpha remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Rat Interleukin-1 alpha should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | Il1a interleukin 1 alpha [ Rattus norvegicus ] |
Official Symbol | Il1a |
Synonyms | IL1A; interleukin 1 alpha; interleukin-1 alpha; IL-1 alpha; |
Gene ID | 24493 |
mRNA Refseq | NM_017019 |
Protein Refseq | NP_058715 |
UniProt ID | P16598 |
◆ Recombinant Proteins | ||
IL1A-5443H | Recombinant Human IL1A protein, His-tagged | +Inquiry |
IL1A-159H | Recombinant Active Human IL1A Protein, His-tagged(C-ter) | +Inquiry |
IL1A-207E | Active Recombinant Equine IL1A | +Inquiry |
IL1A-36682H | Active Recombinant Human IL1A, MIgG2a Fc-tagged | +Inquiry |
IL1A-1298H | Recombinant Human IL1A protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL1A-2911HCL | Recombinant Human IL1A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Il1a Products
Required fields are marked with *
My Review for All Il1a Products
Required fields are marked with *
0
Inquiry Basket