| Species : |
Rat |
| Source : |
P.pastoris |
| Protein Length : |
164 |
| Description : |
Stem Cell Factor (SCF) is a hematopoietic growth factor that binds to the c-Kit receptor. SCF exerts its activity during the early stages of hematopoiesis. SCF stimulates the proliferation of myeloid, erythroid, and lymphoid progenitors in bone marrow cultures and has been shown to act synergistically with colony stimulating factors. |
| Form : |
Sterile Filtered White lyophilized (freeze-dried) powder. |
| Bio-activity : |
ED50 < 25 ng/mL, measured by a cell proliferation assay using TF-1 Cells, corresponding to a specific activity of > 4 × 10^4 units/mg. |
| Molecular Mass : |
18.3 kDa, observed by reducing SDS-PAGE. |
| AA Sequence : |
QEICRNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVTHLSVSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVACMEENAPKNVKESLKKPETRNFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA |
| Endotoxin : |
< 0.2 EU/μg, determined by LAL method. |
| Purity : |
> 95% by SDS-PAGE analysis. |
| Storage : |
Lyophilized recombinant rat Stem Cell Factor (rrSCF) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rrSCF should be stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade. |
| Storage Buffer : |
Lyophilized after extensive dialysis against PBS. |
| Reconstitution : |
Reconstituted in ddH2O at 100 μg/mL. |