Active Recombinant Rat Kitlg Protein
Cat.No. : | Kitlg-164K |
Product Overview : | Recombinant Rat Kitlg Protein without tag was expressed in HEK 293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | HEK293 |
Description : | Stem Cell Factor (SCF) is a hematopoietic growth factor that binds to the c-Kit receptor. SCF exerts its activity during the early stages of hematopoiesis. SCF stimulates the proliferation of myeloid, erythroid, and lymphoid progenitors in bone marrow cultures and has been shown to act synergistically with colony stimulating factors. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 50 ng/mL, measured in a proliferation assay using TF-1 Cells. |
Molecular Mass : | 10~20 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | QEICRNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVTHLSVSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVACMEENAPKNVKESLKKPETRNFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by SDS-PAGE. |
Storage : | Lyophilized recombinant Rat Stem Cell Factor (SCF) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Rat Stem Cell Factor (SCF) should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | Kitlg KIT ligand [ Rattus norvegicus (Norway rat) ] |
Official Symbol | Kitlg |
Synonyms | Kitlg; KIT ligand; Mgf; SCF; Kitl; |
Gene ID | 60427 |
mRNA Refseq | NM_021843 |
Protein Refseq | NP_068615 |
UniProt ID | P21581 |
◆ Recombinant Proteins | ||
KITLG-3748C | Recombinant Chicken KITLG | +Inquiry |
KITLG-055H | Recombinant Human KITLG Protein, His-tagged | +Inquiry |
KITLG-217H | Active Recombinant Human KITLG Protein (Glu26-Ala189), C-His tagged, Animal-free, Carrier-free | +Inquiry |
KITLG-22H | Active Recombinant Human KITLG, MIgG2a Fc-tagged | +Inquiry |
Kitl-501M | Active Recombinant Mouse Interleukin Kitl, MIgG2a Fc-tagged, mutant | +Inquiry |
◆ Cell & Tissue Lysates | ||
KITLG-583MCL | Recombinant Mouse KITLG cell lysate | +Inquiry |
KITLG-571HCL | Recombinant Human KITLG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Kitlg Products
Required fields are marked with *
My Review for All Kitlg Products
Required fields are marked with *
0
Inquiry Basket