| Species : |
Mouse |
| Source : |
E.coli |
| Description : |
Ligand for the receptor-type protein-tyrosine kinase KIT. Plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. KITLG/SCF binding can activate several signaling pathways. Promotes phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, and subsequent activation of the kinase AKT1. KITLG/SCF and KIT also transmit signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. KITLG/SCF and KIT promote activation of STAT family members STAT1, STAT3 and STAT5. KITLG/SCF and KIT promote activation of PLCG1, leading to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate. KITLG/SCF acts synergistically with other cytokines, probably interleukins. |
| Bio-activity : |
The ED50 as determined by the dose-dependent stimulation of the proliferation of the human TF-1 cells is > 10 ng/mL, corresponding to a specific activity of > 1 × 10^5 units/mg. |
| Molecular Mass : |
18.3 kDa |
| AA Sequence : |
MKEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA |
| Endotoxin : |
< 0.1 ng/μg of protein (< 1 EU/μg) |
| Purity : |
> 95% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : |
Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
| Storage : |
Store at -80 centigrade. |
| Storage Buffer : |
LyopH ilized from a 0.2 μM filtered solution of 20 mM pH ospH ate buffer, 100 mM NaCl, pH 7.2 |