Active Recombinant Mouse Kitl Protein
Cat.No. : | Kitl-3697M |
Product Overview : | Purified recombinant protein of Mouse kit ligand (Kitl) without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | Ligand for the receptor-type protein-tyrosine kinase KIT. Plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. KITLG/SCF binding can activate several signaling pathways. Promotes phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, and subsequent activation of the kinase AKT1. KITLG/SCF and KIT also transmit signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. KITLG/SCF and KIT promote activation of STAT family members STAT1, STAT3 and STAT5. KITLG/SCF and KIT promote activation of PLCG1, leading to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate. KITLG/SCF acts synergistically with other cytokines, probably interleukins. |
Bio-activity : | The ED50 as determined by the dose-dependent stimulation of the proliferation of the human TF-1 cells is > 10 ng/mL, corresponding to a specific activity of > 1 × 10^5 units/mg. |
Molecular Mass : | 18.3 kDa |
AA Sequence : | MKEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA |
Endotoxin : | < 0.1 ng/μg of protein (< 1 EU/μg) |
Purity : | > 95% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. |
Storage Buffer : | LyopH ilized from a 0.2 μM filtered solution of 20 mM pH ospH ate buffer, 100 mM NaCl, pH 7.2 |
Gene Name | Kitl kit ligand [ Mus musculus (house mouse) ] |
Official Symbol | Kitl |
Synonyms | KITL; kit ligand; cloud gray; C-kit ligand; Steel factor; grizzle-belly; stem cell factor; mast cell growth factor; hematopoietic growth factor KL; Gb; SF; Sl; Clo; Con; Mgf; SCF; SLF; Kitlg; contrasted |
Gene ID | 17311 |
mRNA Refseq | NM_013598 |
Protein Refseq | NP_038626 |
UniProt ID | P20826 |
◆ Recombinant Proteins | ||
Kitlg-200R | Recombinant Rat Kitlg Protein | +Inquiry |
RFL3095RF | Recombinant Full Length Rat Kit Ligand(Kitlg) Protein, His-Tagged | +Inquiry |
Kitlg-150K | Active Recombinant Rat Kitlg Protein (164 aa) | +Inquiry |
Kitlg-584R | Recombinant Rat Kitlg protein | +Inquiry |
Kitl-61M | Recombinant Mouse Kit Ligand | +Inquiry |
◆ Cell & Tissue Lysates | ||
KITLG-583MCL | Recombinant Mouse KITLG cell lysate | +Inquiry |
KITLG-571HCL | Recombinant Human KITLG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Kitlg Products
Required fields are marked with *
My Review for All Kitlg Products
Required fields are marked with *
0
Inquiry Basket