Active Recombinant Rat VEGF-165 Protein
Cat.No. : | VEGFA-264R |
Product Overview : | Recombinant Rat VEGF-165 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Description : | Vascular endothelial growth factor-A (VEGF-A) is produced by a wide variety of cell types, including tumor and vascular cells. VEGF-A is a mediator of vascular growth, vascular permeability, and plays a role in stimulating vasodilation via nitric oxide-dependent pathways. VEGF-A has several alternatively spliced isoforms, with VEGF-165 being the most abundant. The VEGF-165 isoform is a secreted protein that acts on receptors VEGFR-1 and VEGFR-2 to modulate endothelial cell proliferation and angiogenesis. |
Bio-activity : | HUVEC proliferation, ED50≤8 ng/mL |
Molecular Mass : | Dimer, 19.4/38.8 kDa (165/330 aa) |
AA Sequence : | MAPTTEGEQKAHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNVTMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5 |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | Vegfa vascular endothelial growth factor A [ Rattus norvegicus (Norway rat) ] |
Official Symbol | VEGFA |
Synonyms | VEGFA; vascular endothelial growth factor A; VPF; VEGF-A; vascular permeability factor; Vegf; VEGF164; |
Gene ID | 83785 |
mRNA Refseq | NM_001110333 |
Protein Refseq | NP_001103803 |
UniProt ID | P16612 |
◆ Recombinant Proteins | ||
VEGFA-549H | Active Recombinant Human VEGFA protein | +Inquiry |
Vegfa-7428M | Active Recombinant Mouse Vegfa Protein | +Inquiry |
VEGFA-700H | Recombinant Human VEGFA Protein (Met1-Arg136) | +Inquiry |
Vegfa-014V | Active Recombinant Mouse VEGF165 Protein (165 aa) | +Inquiry |
VEGFA-261H | Active Recombinant Human VEGF-165 Protein | +Inquiry |
◆ Native Proteins | ||
VEGFA-31701TH | Native Human VEGFA | +Inquiry |
◆ Cell & Tissue Lysates | ||
VEGFA-1427HCL | Recombinant Human VEGFA cell lysate | +Inquiry |
VEGFA-727HCL | Recombinant Human VEGFA cell lysate | +Inquiry |
VEGFA-969CCL | Recombinant Canine VEGFA cell lysate | +Inquiry |
VEGFA-974HCL | Recombinant Human VEGFA cell lysate | +Inquiry |
VEGFA-655HCL | Recombinant Human VEGFA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VEGFA Products
Required fields are marked with *
My Review for All VEGFA Products
Required fields are marked with *
0
Inquiry Basket