Active Recombinant Rat Vegf164 Protein (165 aa)
Cat.No. : | Vegfa-145V |
Product Overview : | Recombinant Rat Vegf164 Protein (165 aa) without tag was expressed in P. pastoris. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | P.pastoris |
Protein Length : | 165 |
Description : | Vascular Endothelial Growth Factor A164 (VEGF-A164), a member of the cysteine knot growth factor, is one of major isoforms of VEGF-As. VEGF-As are endothelial cell-specific mitogens with angiogenic and vascular permeability-inducing properties. During maturation, rat VEGF-A is alternatively spliced to generate rVEGF-A120, rVEGF-A164 and rVEGF-A188 which correspond to hVEGF-A121, hVEGF-A165 and hVEGF-A189 in human, respectively (the numbers designate the amino acid residues). The active form of rVEGF-A164 is either a homodimeric or heterodimeric polypeptides which bind to the transmembrane tyrosine kinases receptors FLT1, FLK1 or KDR or to the non-tyrosine kinase neuropilin receptors NRP1/2. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50< 4 ng/mL, measured by cell proliferation assay of HUVEC. |
Molecular Mass : | 38 kDa, observed by non-reducing SDS-PAGE. |
AA Sequence : | MAPTTEGEQKAHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNVTMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPENHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR |
Endotoxin : | < 1 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by reducing SDS-PAGE. |
Storage : | Lyophilized recombinant rat Vascular Endothelial Growth Factor A164(rrVEGF-A164) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rrVEGF-A164 should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | Vegfa vascular endothelial growth factor A [ Rattus norvegicus ] |
Official Symbol | Vegfa |
Synonyms | VEGFA; vascular endothelial growth factor A; VPF; VEGF-A; vascular permeability factor; Vegf; VEGF164; |
Gene ID | 83785 |
mRNA Refseq | NM_001110333 |
Protein Refseq | NP_001103803 |
UniProt ID | P16612 |
◆ Recombinant Proteins | ||
VEGFA-715H | Recombinant Human Vascular Endothelial Growth Factor A | +Inquiry |
VEGFA-549HF | Recombinant Human VEGFA Protein, None-tagged, FITC conjugated | +Inquiry |
VEGFA-210HF | Recombinant Human VEGFA Protein, None-tagged, FITC conjugated | +Inquiry |
Vegfa-7368M | Active Recombinant Mouse Vegfa Protein | +Inquiry |
Vegfa-16M | Recombinant Murine Vascular Endothelial Growth Factor 120 | +Inquiry |
◆ Native Proteins | ||
VEGFA-31701TH | Native Human VEGFA | +Inquiry |
◆ Cell & Tissue Lysates | ||
VEGFA-727HCL | Recombinant Human VEGFA cell lysate | +Inquiry |
VEGFA-1427HCL | Recombinant Human VEGFA cell lysate | +Inquiry |
VEGFA-647MCL | Recombinant Mouse VEGFA cell lysate | +Inquiry |
VEGFA-969CCL | Recombinant Canine VEGFA cell lysate | +Inquiry |
VEGFA-655HCL | Recombinant Human VEGFA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Vegfa Products
Required fields are marked with *
My Review for All Vegfa Products
Required fields are marked with *
0
Inquiry Basket