| Species : |
Rat |
| Source : |
P.pastoris |
| Protein Length : |
165 |
| Description : |
Vascular Endothelial Growth Factor A164 (VEGF-A164), a member of the cysteine knot growth factor, is one of major isoforms of VEGF-As. VEGF-As are endothelial cell-specific mitogens with angiogenic and vascular permeability-inducing properties. During maturation, rat VEGF-A is alternatively spliced to generate rVEGF-A120, rVEGF-A164 and rVEGF-A188 which correspond to hVEGF-A121, hVEGF-A165 and hVEGF-A189 in human, respectively (the numbers designate the amino acid residues). The active form of rVEGF-A164 is either a homodimeric or heterodimeric polypeptides which bind to the transmembrane tyrosine kinases receptors FLT1, FLK1 or KDR or to the non-tyrosine kinase neuropilin receptors NRP1/2. |
| Form : |
Sterile Filtered White lyophilized (freeze-dried) powder. |
| Bio-activity : |
ED50< 4 ng/mL, measured by cell proliferation assay of HUVEC. |
| Molecular Mass : |
38 kDa, observed by non-reducing SDS-PAGE. |
| AA Sequence : |
MAPTTEGEQKAHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNVTMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPENHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR |
| Endotoxin : |
< 1 EU/μg, determined by LAL method. |
| Purity : |
> 95% as analyzed by reducing SDS-PAGE. |
| Storage : |
Lyophilized recombinant rat Vascular Endothelial Growth Factor A164(rrVEGF-A164) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rrVEGF-A164 should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
| Storage Buffer : |
Lyophilized after extensive dialysis against PBS. |
| Reconstitution : |
Reconstituted in ddH2O or PBS at 100 μg/mL. |