Active Recombinant Rat Vegf164 Protein (165 aa)

Cat.No. : Vegfa-145V
Product Overview : Recombinant Rat Vegf164 Protein (165 aa) without tag was expressed in P. pastoris.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : P.pastoris
Protein Length : 165
Description : Vascular Endothelial Growth Factor A164 (VEGF-A164), a member of the cysteine knot growth factor, is one of major isoforms of VEGF-As. VEGF-As are endothelial cell-specific mitogens with angiogenic and vascular permeability-inducing properties. During maturation, rat VEGF-A is alternatively spliced to generate rVEGF-A120, rVEGF-A164 and rVEGF-A188 which correspond to hVEGF-A121, hVEGF-A165 and hVEGF-A189 in human, respectively (the numbers designate the amino acid residues). The active form of rVEGF-A164 is either a homodimeric or heterodimeric polypeptides which bind to the transmembrane tyrosine kinases receptors FLT1, FLK1 or KDR or to the non-tyrosine kinase neuropilin receptors NRP1/2.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50< 4 ng/mL, measured by cell proliferation assay of HUVEC.
Molecular Mass : 38 kDa, observed by non-reducing SDS-PAGE.
AA Sequence : MAPTTEGEQKAHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNVTMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPENHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Endotoxin : < 1 EU/μg, determined by LAL method.
Purity : > 95% as analyzed by reducing SDS-PAGE.
Storage : Lyophilized recombinant rat Vascular Endothelial Growth Factor A164(rrVEGF-A164) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rrVEGF-A164 should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O or PBS at 100 μg/mL.
Gene Name Vegfa vascular endothelial growth factor A [ Rattus norvegicus ]
Official Symbol Vegfa
Synonyms VEGFA; vascular endothelial growth factor A; VPF; VEGF-A; vascular permeability factor; Vegf; VEGF164;
Gene ID 83785
mRNA Refseq NM_001110333
Protein Refseq NP_001103803
UniProt ID P16612

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Vegfa Products

Required fields are marked with *

My Review for All Vegfa Products

Required fields are marked with *

0
cart-icon
0
compare icon