Active Recombinant Rat Vegf165 Protein

Cat.No. : Vegfa-199V
Product Overview : Recombinant Rat Vegf165 Protein without tag was expressed in CHO.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : CHO
Description : Vascular Endothelial Growth Factor (VEGF) is a potent growth and angiogenic cytokine. It stimulates proliferation and survival of endothelial cells, and promotes angiogenesis and vascular permeability. Expressed in vascularized tissues, Vascular Endothelial Growth Factor (VEGF) plays a prominent role in normal and pathological angiogenesis. Substantial evidence implicates Vascular Endothelial Growth Factor (VEGF) in the induction of tumor metastasis and intra-ocular neovascular syndromes. Vascular Endothelial Growth Factor (VEGF) signals through the three receptors; fms-like tyrosine kinase (flt-1), KDR gene product (the murine homolog of KDR is the flk-1 gene product) and the flt4 gene product.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50 < 4 ng/mL, measured in a cell proliferation assay using HUVEC cells, corresponding to a specific activity of >2.5 5 units/mg
Molecular Mass : 35-48 kDa, observed by non-reducing SDS-PAGE.
AA Sequence : APTTEGEQKAHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNVTMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPENHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% as analyzed by SDS-PAGE and HPLC.
Storage : Lyophilized recombinant Rat Vascular Endothelial Growth Factor 165 (VEGF165) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rrVEGF165 should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O or PBS at 100 μg/mL.
Gene Name Vegfa vascular endothelial growth factor A [ Rattus norvegicus ]
Official Symbol Vegfa
Synonyms VEGFA; vascular endothelial growth factor A; VPF; VEGF-A; vascular permeability factor; Vegf; VEGF164;
Gene ID 83785
mRNA Refseq NM_001110333
Protein Refseq NP_001103803
UniProt ID P16612

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Vegfa Products

Required fields are marked with *

My Review for All Vegfa Products

Required fields are marked with *

0
cart-icon