Recombinant Rhesus CSF3 protein

Cat.No. : CSF3-387R
Product Overview : Recombinant Rhesus CSF3 protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rhesus macaque
Source : E.coli
Tag : Non
Protein Length : 174
Description : The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of granulocytes. The active protein is found extracellularly. Alternatively spliced transcript variants have been described for this gene.
Form : Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine NFS-60 cells is less than 0.05 ng/ml, corresponding to a specific activity of > 2.0 × 10⁷ IU/mg.
Molecular Mass : Approximately 18.9 kDa, a single non-glycosylated polypeptide chain containing 174 amino acids.
AA Sequence : TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLRHSLGIPWAPLSSCPSQALQLTGCLSQLHSSLFLYQGLLQALEGISPELSPTLDTLQLDIADFATTIWQQMEDLGMAPALQPTQGAMPAFTSAFQRRAGGVLVASHLQRFLELAYRVLRHLAQS
Endotoxin : Less than 0.1 EU/μg of rRhG-CSF as determined by LAL method.
Purity : >98% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name CSF3
Official Symbol CSF3
Gene ID 698961
mRNA Refseq XM_001095097.4
Protein Refseq XP_001095097.2
UniProt ID F7H1Q6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CSF3 Products

Required fields are marked with *

My Review for All CSF3 Products

Required fields are marked with *

0
cart-icon
0
compare icon