| Species : |
Mouse |
| Source : |
E.coli |
| Tag : |
Non |
| Protein Length : |
111 |
| Description : |
Murine Interleukin-13 (IL-13) is expressed by the IL13 gene located on the chromosome 11 and secreted by many cell types, especially T helper type 2 (Th2) cells. Targeted deletion of IL-13 in mice resulted in impaired Th2 cell development and indicated an important role for IL-13 in the expulsion of gastrointestinal parasites. IL-13 has been implicated as a key factor in asthma, allergy, atopy and inflammatory response, establishing the protein as a valuable therapeutic target. Human, mouse and rat IL-3 share low homology, but have cross species activity. |
| Form : |
Lyophilized from a 0.2μm filtered solution in PBS, pH 7.4. |
| Bio-activity : |
Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human TF-1 cells is less than 4 ng/ml, corresponding to a specific activity of > 2.5 × 10⁵ IU/mg. |
| Molecular Mass : |
Approximately 12.3 kDa, a single non-glycosylated polypeptide chain containing 111 amino acids. |
| AA Sequence : |
MPVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF |
| Endotoxin : |
Less than 1 EU/µg of rMuIL-13 as determined by LAL method. |
| Purity : |
>97% by SDS-PAGE and HPLC analysis. |
| Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
| Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |