Active Recombinant Mouse Il13 Protein
Cat.No. : | Il13-087M |
Product Overview : | Purified recombinant protein of Mouse interleukin 13 (Il13) without tag was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | Cytokine. Inhibits inflammatory cytokine production. Synergizes with IL2 in regulating interferon-gamma synthesis. May be critical in regulating inflammatory and immune responses. Positively regulates IL31RA expression in macrophages. |
Bio-activity : | The ED50 as determined by the dose-dependent proliferation of TF-1 cells was > 4.0 ng/ml, corresponding to a specific activity of > 2.5 x 10^5 units/mg. |
Molecular Mass : | 12.3 kDa |
AA Sequence : | MPVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF |
Endotoxin : | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Purity : | >95%, as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. |
Storage Buffer : | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Reconstitution : | Resuspend the protein in the desired concentration in proper buffer. |
Publications : |
IFN-γ Limits Immunopathogenesis but Delays Fungal Clearance during Pneumocystis Pneumonia (2023)
|
Gene Name | Il13 interleukin 13 [ Mus musculus (house mouse) ] |
Official Symbol | Il13 |
Synonyms | Il13; interleukin 13; Il-13; interleukin-13; T-cell activation protein P600 |
Gene ID | 16163 |
mRNA Refseq | NM_008355 |
Protein Refseq | NP_032381 |
UniProt ID | P20109 |
◆ Recombinant Proteins | ||
IL13-124H | Recombinant Human IL13 protein | +Inquiry |
Il13-1661R | Recombinant Rat Il13 Protein, His-tagged | +Inquiry |
Il13-68M | Recombinant Mouse Interleukin 13 | +Inquiry |
IL13-3170C | Recombinant Cat IL13 protein(34-144aa), His-tagged | +Inquiry |
IL13-481H | Active Recombinant Human Interleukin 13 | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL13-2922HCL | Recombinant Human IL13 cell lysate | +Inquiry |
IL13-1894CCL | Recombinant Cynomolgus IL13 cell lysate | +Inquiry |
IL13-1336MCL | Recombinant Mouse IL13 cell lysate | +Inquiry |
IL13-001HCL | Recombinant Human IL13 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Il13 Products
Required fields are marked with *
My Review for All Il13 Products
Required fields are marked with *
0
Inquiry Basket