Recombinant Mouse Il13 protein
Cat.No. : | Il13-629M |
Product Overview : | Recombinant Mouse Il13 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | Non |
Protein Length : | 111 |
Description : | Murine Interleukin-13 (IL-13) is expressed by the IL13 gene located on the chromosome 11 and secreted by many cell types, especially T helper type 2 (Th2) cells. Targeted deletion of IL-13 in mice resulted in impaired Th2 cell development and indicated an important role for IL-13 in the expulsion of gastrointestinal parasites. IL-13 has been implicated as a key factor in asthma, allergy, atopy and inflammatory response, establishing the protein as a valuable therapeutic target. Human, mouse and rat IL-3 share low homology, but have cross species activity. |
Form : | Lyophilized from a 0.2μm filtered solution in PBS, pH 7.4. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human TF-1 cells is less than 4 ng/ml, corresponding to a specific activity of > 2.5 × 10⁵ IU/mg. |
Molecular Mass : | Approximately 12.3 kDa, a single non-glycosylated polypeptide chain containing 111 amino acids. |
AA Sequence : | MPVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF |
Endotoxin : | Less than 1 EU/µg of rMuIL-13 as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | Il13 |
Official Symbol | Il13 |
Synonyms | IL13; interleukin 13; interleukin-13; T-cell activation protein P600; Il-13; |
Gene ID | 16163 |
mRNA Refseq | NM_008355 |
Protein Refseq | NP_032381 |
UniProt ID | P20109 |
◆ Recombinant Proteins | ||
Il13-038I | Active Recombinant Mouse Il13 Protein (111 aa) | +Inquiry |
IL-13-3015H | Recombinant Human IL-13 protein, His-tagged | +Inquiry |
IL13-459H | Active Recombinant Human IL13 protein, hFc-tagged | +Inquiry |
IL13-14149H | Recombinant Human IL13, His-tagged | +Inquiry |
IL13-7888Z | Recombinant Zebrafish IL13 | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL13-1336MCL | Recombinant Mouse IL13 cell lysate | +Inquiry |
IL13-001HCL | Recombinant Human IL13 cell lysate | +Inquiry |
IL13-2922HCL | Recombinant Human IL13 cell lysate | +Inquiry |
IL13-1894CCL | Recombinant Cynomolgus IL13 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Il13 Products
Required fields are marked with *
My Review for All Il13 Products
Required fields are marked with *
0
Inquiry Basket