"ALDOB" Related Products

Expand

Recombinant Human Aldolase B, Fructose-Bisphosphate, His-tagged

Cat. No.: ALDOB-1918H
Product Overview: Recombinant humanALDOB protein, fused to His-tag at N-terminus, was expressed in E. coli andpurified by using conventional chromatography techniques.
Description: ALDOB isone of three known aldolase isoenzymes, and is found in kidney and smalladult intestine where it is associated with aldolases A or C. ALDOB catalyzesthe reversible cleavage of fructose 1-phosphate into dihydroxyacetonephosphate and glyceraldehyde.
Form: Liquid. In 20mMTris-HCl buffer (pH 8.0) containing 1mM DTT, 10% glycerol, 0.1M NaCl.
Molecular Weight: 42 kDa(388aa) confirmed by MALDI-TOF
Purity: > 95%by SDS-PAGE
Concentration: 1 mg/ml(determined by Bradford assay)
Sequences of aminoacids: MGSSHHHHHHSSGLVPRGSH MGSHMAHRFP ALTQEQKKEL SEIAQSIVAN GKGILAADES VGTMGNRLQR IKVENTEENRRQFREILFSVDSSINQSIGGVILFHETLYQ KDSQGKLFRN ILKEKGIVVG IKLDQGGAPL AGTNKETTIQ GLDGLSERCA QYKKDGVDFGKWRAVLRIAD QCPSSLAIQE NANALARYAS ICQQNGLVPI VEPEVIPDGD HDLEHCQYVT EKVLAAVYKALNDHHVYLEG TLLKPNMVTA GHACTKKYTP EQVAMATVTALHRTVPAAVP GICFLSGGMS EEDATLNLNA INLCPLPKPW KLSFSYGRAL QASALAAWGG KAANKEATQEAFMKRAMANC QAAKGQYVHT GSSGAASTQS LFTACYTY
Storage: Can bestored at +4°C short term (1-2 weeks). For long term storage, aliquot andstore at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Pathways: FOXA2 and FOXA3 transcription factornetworks; Fructose and mannose metabolism; Fructose catabolism;Gluconeogenesis; Glucose metabolism; Glycolysis; Glycolysis (Embden-Meyerhofpathway); Glycolysis / Gluconeogenesis; Glycolysis and Gluconeogenesis;Metabolic pathways; Metabolism of carbohydrates; Pentose phosphate pathway
Gene Name: ALDOB aldolase B,fructose-bisphosphate [ Homo sapiens ]
Official Symbol: ALDOB
Synonyms: ALDOB; aldolase B, fructose-bisphosphate; ALDB;ALDO2; fructose-bisphosphate aldolase B; aldolase 2; liver-type aldolase;aldolase B, fructose-bisphosphatase; EC 4.1.2.13
Gene ID: 229
mRNA Refseq: NM_000035
Protein Refseq: NP_000026
MIM: 612724
UniProt ID: P05062
Chromosome Location: 9q21.3-q22.2
Function: ATPase binding; cytoskeletal proteinbinding; fructose binding; fructose-bisphosphate aldolase activity; identicalprotein binding; lyase activity; phosphatidylcholine binding; protein binding

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.