Recombinant Human ALDOB
Cat.No. : | ALDOB-26495TH |
Product Overview : | Recombinant fragment of Human ALDOB with an N terminal proprietary tag; Predicted MWt 34.76 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 83 amino acids |
Description : | Fructose-1,6-bisphosphate aldolase (EC 4.1.2.13) is a tetrameric glycolytic enzyme that catalyzes the reversible conversion of fructose-1,6-bisphosphate to glyceraldehyde 3-phosphate and dihydroxyacetone phosphate. Vertebrates have 3 aldolase isozymes which are distinguished by their electrophoretic and catalytic properties. Differences indicate that aldolases A, B, and C are distinct proteins, the products of a family of related housekeeping genes exhibiting developmentally regulated expression of the different isozymes. The developing embryo produces aldolase A, which is produced in even greater amounts in adult muscle where it can be as much as 5% of total cellular protein. In adult liver, kidney and intestine, aldolase A expression is repressed and aldolase B is produced. In brain and other nervous tissue, aldolase A and C are expressed about equally. There is a high degree of homology between aldolase A and C. Defects in ALDOB cause hereditary fructose intolerance. |
Molecular Weight : | 34.760kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | DSQGKLFRNILKEKGIVVGIKLDQGGAPLAGTNKETTIQGLDGLSERCAQYKKDGVDFGKWRAVLRIADQCPSSLAIQENANA |
Sequence Similarities : | Belongs to the class I fructose-bisphosphate aldolase family. |
Gene Name | ALDOB aldolase B, fructose-bisphosphate [ Homo sapiens ] |
Official Symbol | ALDOB |
Synonyms | ALDOB; aldolase B, fructose-bisphosphate; fructose-bisphosphate aldolase B; |
Gene ID | 229 |
mRNA Refseq | NM_000035 |
Protein Refseq | NP_000026 |
MIM | 612724 |
Uniprot ID | P05062 |
Chromosome Location | 9q21.3-q22.2 |
Pathway | FOXA2 and FOXA3 transcription factor networks, organism-specific biosystem; Fructose and mannose metabolism, organism-specific biosystem; Fructose and mannose metabolism, conserved biosystem; Fructose catabolism, organism-specific biosystem; Gluconeogenesis, organism-specific biosystem; |
Function | ATPase binding; cytoskeletal protein binding; fructose binding; fructose-bisphosphate aldolase activity; fructose-bisphosphate aldolase activity; |
◆ Recombinant Proteins | ||
ALDOB-0641H | Recombinant Human ALDOB Protein (Thr9-Tyr364), N-His-tagged | +Inquiry |
ALDOB-1817C | Recombinant Chicken ALDOB | +Inquiry |
ALDOB-456H | Recombinant Human ALDOB Protein, GST-tagged | +Inquiry |
Aldob-1596M | Recombinant Mouse Aldob Protein, Myc/DDK-tagged | +Inquiry |
ALDOB-505H | Recombinant Human ALDOB protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ALDOB-8911HCL | Recombinant Human ALDOB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ALDOB Products
Required fields are marked with *
My Review for All ALDOB Products
Required fields are marked with *