Recombinant Human Eukaryotic Translation Initiation Factor 4H, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human Eukaryotic Translation Initiation Factor 4H, His-tagged

Recombinant Human Eukaryotic Translation Initiation Factor 4H, His-tagged

EIF4H Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat. No. : EIF4H-6789H
Product Overview : Recombinant humanEIF4H protein, fused to His-tag at N-terminus, was expressed in E.coli andpurified by using conventional chromatography techniques
Description : Eukaryotictranslation initiation factor 4H, also known as EIF4H, is a 248 amino acidprotein that localizes to the perinuclear region of the cytoplasm and isexpressed as two isoforms, designated short and long. EIF4H induces theRNA-dependent ATP hydrolysis catalyzed by the initiation factors EIF4A andEIF4B. EIF4H was further shown to stimulate the initial rate and extent ofEIF4A-mediated mRNA secondary structure unwinding. Defects in the geneencoding EIF4H are associated with Williams- Beuren syndrome (WBS), a raredevelopmental disorder characterized by cardiovascular and musculo-skeletalabnormalities
Form : Liquid. In 20mMTris-HCl buffer (pH 8.0) containing 0.2M NaCl, 50% glycerol, 2mM DTT
Molecular Weight : 29.9 kDa (272aa),confirmed by MALDI-TOF
Purity : > 90% by SDS -PAGE
Concentration : 0.5 mg/ml(determined by Bradford assay)
Sequences of aminoacids : MGSSHHHHHHSSGLVPRGSH MGSHMADFDT YDDRAYSSFG GGRGSRGSAG GHGSRSQKEL PTEPPYTAYV GNLPFNTVQGDIDAIFKDLSIRSVRLVRDK DTDKFKGFCY VEFDEVDSLK EALTYDGALL GDRSLRVDIA EGRKQDKGGFGFRKGGPDDR GMGSSRESRG GWDSRDDFNS GFRDDFLGGR GGSRPGDRRT GPPMGSRFRD GPPLRGSNMDFREPTEEERA QRPRLQLKPR TVATPLNQVA NPNSAIFGGA RPREEVVQKEQE
Storage : Can be stored at+4°C short term (1-2 weeks). For long term storage, aliquot and store at-20°C or -70°C. Avoid repeated freezing and thawing cycles.
PDB rendering based on 2dng. :

Gene Name : EIF4Heukaryotic translation initiation factor 4H [ Homo sapiens ]
Official Symbol : EIF4H
Synonyms : EIF4H; eukaryotic translationinitiation factor 4H; WBSCR1, Williams Beuren syndrome chromosome region 1;KIAA0038; WSCR1; E430026L18Rik; Ef4h; AU018978; D5Ertd355e; eIF 4H; eIF-4H;EIF4H; Eukaryotic translation initiation factor 4H; IF4H_HUMAN; KIAA0038;WBSCR1; Williams Beuren syndrome chromosomal region 1 protein homolog;Williams Beuren syndrome chromosome region 1; Williams-Beuren syndromechromosomal region 1 protein; WSCR1; Williams-Beuren syndrome chromosomeregion 1; WBSCR1; eIF-4H
Gene ID : 7458
mRNA Refseq : NM_031992
Protein Refseq : NP_114381
MIM : 603431
Uniprot ID : Q15056
Chromosome Location : 7q11.23
Pathway : Activation of the mRNA upon bindingof the cap-binding complex and eIFs, and subsequent binding to 43S,organism-specific biosystem; Cap-dependent Translation Initiation,organism-specific biosystem; Eukaryotic Translation Initiation,organism-specific biosystem; GTP hydrolysis and joining of the 60S ribosomalsubunit, organism-specific biosystem; Gene Expression, organism-specificbiosystem
Function : RNA binding; nucleotide binding;protein binding; translation factor activity, nucleic acid binding;translation initiation factor activity
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Online Inquiry


  • Note: There will be extra charge for optional service!

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2021 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy