"SOCS3" Related Products

Expand
Expand
Expand

Recombinant Human Suppressor Of Cytokine Signaling 3, GST-tagged

Cat. No.: SOCS3-6941H
Product Overview: RecombinantHuman SOCS3 protein wasexpressed as GST-tagged fusion protein by vitro wheatgerm.
Description: SOCS3is a protein that in humans is encoded by the SOCS3 gene. This gene encodes amember of the STAT-induced STAT inhibitor (SSI), also known as suppressor ofcytokine signaling (SOCS), family. SSI family members are cytokine-induciblenegative regulators of cytokine signaling. The expression of this gene isinduced by various cytokines, including IL6, IL10, and interferon(IFN)-gamma. The protein encoded by this gene can bind to JAK2 kinase, andinhibit the activity of JAK2 kinase.
Species: Human
Quality ControlTesting: 12.5%SDS-PAGE Stained with Coomassie Blue.
Sequence: MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGAPSFPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
Preparation Method: in vitro wheatgerm expression system
Molecular Weight: 50.49 kDa
Purification: GlutathioneSepharose 4 Fast Flow.
Buffer: 50 mMTris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage: Storeat -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Name: SOCS3 suppressor of cytokine signaling 3 [ Homosapiens ]
Official Symbol: SOCS3
Synonyms: SOCS3;suppressor of cytokine signaling 3; CIS3; SSI3; ATOD4; Cish3;SSI-3; SOCS-3; MGC71791; CIS-3; STAT-induced STAT inhibitor 3; cytokine-inducedSH2 protein 3; cytokine-inducible SH2 protein 3
Gene ID: 9021
mRNA Refseq: NM_003955
Protein Refseq: NP_003946
MIM: 604176
UniProt ID: O14543
Chromosome Location: 17q25.3
Pathway: ATF-2 transcription factor network; Adipocytokinesignaling pathway; Class I MHC mediated antigen processing & presentation;Cytokine Signaling in Immune system; ECS complex; EGFR1 Signaling Pathway; EPOsignaling pathway; Growth hormone receptor signaling; Herpes simplexinfection; IL-2 Signaling Pathway; IL-3 Signaling Pathway; IL-4 SignalingPathway; IL-6 Signaling Pathway; IL-9 Signaling Pathway
Function: protein kinase inhibitor activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.