Recombinant Human FGF21 Full Length protein, His-tagged

• Cat.No.: FGF21-564H
• Product Overview: Recombinant Human FGF21 protein(His29-Ser209), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: His29-Ser209
• Tag: N-His
• Form: Liquid in sterile PBS, pH7.4, 5% Trehalose.
• Molecular Mass: The protein has a calculated MW of 20 kDa.
• Endotoxin: <1.0EU per 1μg (determined by the LAL method).
• Purity: > 90 % as determined by SDS-PAGE.
• Storage: Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 1.0 mg/ml.
• Reconstitution: Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: MHHHHHHHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS

Gene Information

• Gene Name: FGF21 fibroblast growth factor 21 [ Homo sapiens ]
• Official Symbol: FGF21
• Synonyms: FGF21; fibroblast growth factor 21; FGF-21
• Gene ID: 26291
• mRNA Refseq: NM_019113
• Protein Refseq: NP_061986
• MIM: 609436
• UniProt ID: Q9NSA1