Recombinant Human FGF21 Full Length protein, His-tagged
Cat.No. : | FGF21-564H |
Product Overview : | Recombinant Human FGF21 protein(His29-Ser209), fused with N-terminal His tag, was expressed in E. coli. |
Availability | July 12, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | His29-Ser209 |
Tag : | N-His |
Form : | Liquid in sterile PBS, pH7.4, 5% Trehalose. |
Molecular Mass : | The protein has a calculated MW of 20 kDa. |
Endotoxin : | <1.0EU per 1μg (determined by the LAL method). |
Purity : | > 90 % as determined by SDS-PAGE. |
Storage : | Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 1.0 mg/ml. |
Reconstitution : | Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | MHHHHHHHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS |
Gene Name | FGF21 fibroblast growth factor 21 [ Homo sapiens ] |
Official Symbol | FGF21 |
Synonyms | FGF21; fibroblast growth factor 21; FGF-21; |
Gene ID | 26291 |
mRNA Refseq | NM_019113 |
Protein Refseq | NP_061986 |
MIM | 609436 |
UniProt ID | Q9NSA1 |
◆ Recombinant Proteins | ||
FGF21-626B | Recombinant Bovine Fibroblast Growth Factor 21 | +Inquiry |
FGF21-4310Z | Recombinant Zebrafish FGF21 | +Inquiry |
FGF21-932P | Recombinant Pig FGF21 Protein, His&GST-tagged | +Inquiry |
FGF21-034H | Active Recombinant Human FGF21 Protein | +Inquiry |
FGF21-5381H | Recombinant Human FGF21 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF21-1890MCL | Recombinant Mouse FGF21 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FGF21 Products
Required fields are marked with *
My Review for All FGF21 Products
Required fields are marked with *