"TARDBP" Related Products

Expand
Expand
Expand

Recombinant Human TARDBP, GST-tagged

Cat.No.: TARDBP-4735H
Product Overview: Recombinant Human TARDBP(1 a.a. - 260 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description: HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. The protein encoded by this gene is a transcriptional repressor that binds to chromosomally integrated TAR DNA and represses HIV-1 transcription. In addition, this protein regulates alternate splicing of the CFTR gene. A similar pseudogene is present on chromosome 20.
Source: Wheat germ
Species: Human
Tag: GST
Molecular Mass: 54.34 kDa
AA Sequence: MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGILHAPDAGWGNLVYVV NYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFV RFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKP FRAFAFVTFADDQIAQSLCGEDLIIKGISVHISNA
Applications: ELISA; WB-Re; AP; Array
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: TARDBP TAR DNA binding protein [ Homo sapiens (human) ]
Official Symbol: TARDBP
Synonyms: TARDBP; TDP-43; TAR DNA binding protein; ASL 10; TAR DNA-binding protein 43; TDP43; TAR DNA-binding protein 43; OTTHUMP00000002173; TRA DNA-binding protein-43
Gene ID: 23435
mRNA Refseq: NM_007375
Protein Refseq: NP_003140
MIM: 605078
UniProt ID: Q13148
Chromosome Location: 1p36.22
Function: RNA binding; double-stranded DNA binding; mRNA 3'-UTR binding; nucleotide binding; protein binding; sequence-specific DNA binding transcription factor activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.