Active Recombinant Human Tumor Necrosis Factor Receptor Superfamily, Member 11b
Cat.No. : | TNFRSF11B-4141H |
Product Overview : | Recombinant OPG produced in yeast contains 412 amino acid residues, including 180 residues from mature OPG (a.a 22-201) and 232 residues from the Fc protein of human IgG1, and has a calculated molecular mass of 46.5 kDa. As a result of glycosylation, the recombinant Osteoprotegrin migrates as a 49 kDa protein in SDS-PAGE under reducing conditions. The OPG is purified by proprietary chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Cat. No. : | TNFRSF11B-4141H |
Description : | Osteoprotegerin acts as decoy receptor for rankl and thereby neutralizes its function in osteoclastogenesis. OPG inhibits the activation of osteoclasts and promotes osteoclast apoptosis in vitro. Bone homeostasis seems to depend on the local rankl/opg ratio. Osteoprotegerin may also play a role in preventing arterial calcification. May act as decoy receptor for trail and protect against apoptosis. Trail binding blocks the inhibition of osteoclastogenesis. |
Source : | Human |
Host : | Pichia Pastoris |
Form : | OPG was lyophilized from a 0.2μm filtered concentrated (0.5mg/ml) solution in PBS, pH= 7.4. |
Purity : | Greater than 90.0% as determined by(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. |
Bio-activity : | Determined by its ability to neutralize the stimulation of U937 cells treated with 10ng/ml of soluble RANKL (sRANKL) corresponding to a Specific Activity of 100,000IU/mg. |
Physical Appearance : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Solubility : | It is recommended to reconstitute the lyophilized Osteoprotegerin in sterile 18Mμ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions. |
Amino acid sequence : | AA Sequence: OPG 22-201: ETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYY, TDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCL, KHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCS, VFGLLLTQKGNATHDNICSGNSESTQKCGIDVTL. |
Storage : | Lyophilized Osteoprotegerin although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution OCIF should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles. |
Gene Name : | TNFRSF11B tumor necrosis factor receptor superfamily, member 11b [ Homo sapiens ] |
Official Symbol : | TNFRSF11B |
Synonyms : | TNFRSF11B, OPG, OCIF, Osteoclastogenesis inhibitory factor, TR1, MGC29565, Osteoprotegerin, TR1, Osteoclastogenesis inhibitory factor, tumor necrosis factor receptor superfamily, member 11b |
Gene ID : | 4982 |
mRNA Refseq : | NM_002546 |
Protein Refseq : | NP_002537 |
MIM : | 602643 |
UniProt ID : | O00300 |
Chromosome Location : | 8q24 |
Pathway : | Cytokine-cytokine receptor interaction; Monoamine Transport; Osteoclast Signaling; Osteoclast differentiation |
Function : | cytokine activity; protein binding; receptor activity |
Products Types
◆ Recombinant Protein | ||
Tnfrsf11b-113M | Recombinant Mouse Tnfrsf11b Protein, His (Fc)-Avi-tagged | +Inquiry |
TNFRSF11B-365H | Recombinant Human TNFRSF11B Protein (Met1-Leu401), HIgG1 Fc-tagged | +Inquiry |
TNFRSF11B-2455H | Recombinant Human TNFRSF11B protein(22-401 aa), N-MBP & C-His-tagged | +Inquiry |
TNFRSF11B-4496H | Recombinant Human TNFRSF11B Protein, His (Fc)-Avi-tagged | +Inquiry |
TNFRSF11B-5853R | Recombinant Rat TNFRSF11B Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Protein | ||
TNFRSF11B-54H | Native Human Osteoprotegerin | +Inquiry |
◆ Lysates | ||
TNFRSF11B-2176HCL | Recombinant Human TNFRSF11B cell lysate | +Inquiry |
TNFRSF11B-1183CCL | Recombinant Cynomolgus TNFRSF11B cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All TNFRSF11B Products
Required fields are marked with *
My Review for All TNFRSF11B Products
Required fields are marked with *
0
Inquiry Basket