Active Recombinant Human Tumor Necrosis Factor Receptor Superfamily, Member 11b

Cat.No. : TNFRSF11B-4141H
Product Overview : Recombinant OPG produced in yeast contains 412 amino acid residues, including 180 residues from mature OPG (a.a 22-201) and 232 residues from the Fc protein of human IgG1, and has a calculated molecular mass of 46.5 kDa. As a result of glycosylation, the recombinant Osteoprotegrin migrates as a 49 kDa protein in SDS-PAGE under reducing conditions. The OPG is purified by proprietary chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Human
Tag : Non
Protein Length : 22-201 a.a.
Description : Osteoprotegerin acts as decoy receptor for rankl and thereby neutralizes its function in osteoclastogenesis. OPG inhibits the activation of osteoclasts and promotes osteoclast apoptosis in vitro. Bone homeostasis seems to depend on the local rankl/opg ratio. Osteoprotegerin may also play a role in preventing arterial calcification. May act as decoy receptor for trail and protect against apoptosis. Trail binding blocks the inhibition of osteoclastogenesis.
Form : OPG was lyophilized from a 0.2μm filtered concentrated (0.5mg/ml) solution in PBS, pH= 7.4.
Purity : Greater than 90.0% as determined by(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Bio-activity : Determined by its ability to neutralize the stimulation of U937 cells treated with 10ng/ml of soluble RANKL (sRANKL) corresponding to a Specific Activity of 100,000IU/mg.
Physical Appearance : Sterile Filtered White lyophilized (freeze-dried) powder.
Solubility : It is recommended to reconstitute the lyophilized Osteoprotegerin in sterile 18Mμ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Amino acid sequence : AA Sequence: OPG 22-201: ETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYY, TDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCL, KHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCS, VFGLLLTQKGNATHDNICSGNSESTQKCGIDVTL.
Storage : Lyophilized Osteoprotegerin although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution OCIF should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Gene Name TNFRSF11B tumor necrosis factor receptor superfamily, member 11b [ Homo sapiens ]
Official Symbol TNFRSF11B
Synonyms TNFRSF11B, OPG, OCIF, Osteoclastogenesis inhibitory factor, TR1, MGC29565, Osteoprotegerin, TR1, Osteoclastogenesis inhibitory factor, tumor necrosis factor receptor superfamily, member 11b
Gene ID 4982
mRNA Refseq NM_002546
Protein Refseq NP_002537
MIM 602643
UniProt ID O00300
Chromosome Location 8q24
Pathway Cytokine-cytokine receptor interaction; Monoamine Transport; Osteoclast Signaling; Osteoclast differentiation
Function cytokine activity; protein binding; receptor activity

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TNFRSF11B Products

Required fields are marked with *

My Review for All TNFRSF11B Products

Required fields are marked with *

0
cart-icon
0
compare icon