| Species : |
Human |
| Source : |
E.coli |
| Tag : |
Non |
| Protein Length : |
174 |
| Description : |
Granulocyte colony stimulating factor (G-CSF) is a pleiotropic cytokine. It is mainly produced by monocytes and macrophages upon activation by endotoxin, TNF-α and IFN-γ. Besides, many other cell types can secreted this protein after LPS, IL-1 or TNF-α activation, which are fibroblasts, endothelial cells, astrocytes and bone marrow stromal cells. Various carcinoma cell lines and myeloblastic leukemia cells can express G-CSF constitutively. G-CSF is cytokine that acts in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. In addition it may function in some adhesion or recognition events at the cell surface. In humans, two distinct cDNA clones for G-CSF, encoding 207 and 204 amino acid (a.a.) precursor proteins, have been isolated. Both proteins have a 30 a.a. signal peptide and have identical amino acid sequences except for a three a.a. insertion (deletion) at the 35th a.a. residue from the N-terminus of the mature protein. Human G-CSF is 73 % identical at the amino acid level to murine G-CSF and the two proteins show species cross-reactivity. |
| Form : |
Lyophilized from a 0.2μm filtered concentrated solution in 10mM sodium acetate buffer, containing 5 % trehalose, pH 4.0. |
| Bio-activity : |
Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine NFS-60 cells is less than 0.1 ng/ml, corresponding to a specific activity of > 1.0 × 10⁷ IU/mg. |
| Molecular Mass : |
Approximately 18.7 kDa, a single non-glycosylated polypeptide chain containing 174 amino acids. |
| AA Sequence : |
TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP |
| Endotoxin : |
Less than 1 EU/μg of rHuG-CSF as determined by LAL method. |
| Purity : |
>98% by SDS-PAGE and HPLC analysis. |
| Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
| Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |