"FA2H" Related Products

Expand
Expand
Expand

Recombinant Human FA2H, GST-tagged

Cat. No.: FA2H-893H
Product Overview: Recombinant Human FA2H (1 a.a. - 372 a.a.) fused with GST-tag at N-terminal, was expressed in vitro wheat germ expression system.
Description: This gene encodes a protein that catalyzes the synthesis of 2-hydroxysphingolipids, a subset of sphingolipids that contain 2-hydroxy fatty acids. Sphingolipids play roles in many cellular processes and their structural diversity arises from modification of the hydrophobic ceramide moiety, such as by 2-hydroxylation of the N-acyl chain, and the existence of many different head groups. Mutations in this gene have been associated with leukodystrophy dysmyelinating with spastic paraparesis with or without dystonia.
Source: Wheat germ
Molecular Mass: 69.2 kDa
Sequence: MAPAPPPAASFSPSEVQRRLAAGACWVRRGARLYDLSSFVRHHPGGEQLLRARAGQDISADLDGPPHRHSANARRWLEQYYVGELRGEQQGSMENEPVALEETQKTDPAMEPRFKVVDWDKDLVDWRKPLLWQVGHLGEKYDEWVHQPVTRPIRLFHSDLIEGLSKTVWYSVPIIWVPLVLYLSWSYYRTFAQGNVRLFTSFTTEYTVAVPKSMFPGLFMLGTFLWSLIEYLIHRFLFHMKPPSDSYYLIMLHFVMHGQHHKAPFDGSRLVFPPVPASLVIGVFYLCMQLILPEAVGGTVFAGGLLGYVLYDMTHYYLHFGSPHKGSYLYSLKAHHVKHHFAHQKSGFGISTKLWDYCFHTLTPEKPHLKTQ
Storagebuffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Applications: ELISA; WB
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
OfficialSymbol: FA2H
Gene Name: FA2H fatty acid 2-hydroxylase [ Homo sapiens ]
Synonyms: FA2H; fatty acid 2-hydroxylase; FAAH; FAH1; SCS7; SPG35; FAXDC1; fatty acid alpha-hydroxylase; fatty acid hydroxylase domain containing 1; spastic paraplegia 35 (autosomal recessive); EC 1.-.-.-; FLJ25287
Gene ID: 79152
mRNA Refseq: NM_024306
Protein Refseq: NP_077282
MIM: 611026
UniProt ID: Q7L5A8
Chromosome Location: 16q23
Function: fatty acid alpha-hydroxylase activity; heme binding; iron ion binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.