Recombinant Human FA2H, GST-tagged

• Cat.No.: FA2H-893H
• Product Overview: Recombinant Human FA2H (1 a.a. - 372 a.a.) fused with GST-tag at N-terminal, was expressed in vitro wheat germ expression system.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a protein that catalyzes the synthesis of 2-hydroxysphingolipids, a subset of sphingolipids that contain 2-hydroxy fatty acids. Sphingolipids play roles in many cellular processes and their structural diversity arises from modification of the hydrophobic ceramide moiety, such as by 2-hydroxylation of the N-acyl chain, and the existence of many different head groups. Mutations in this gene have been associated with leukodystrophy dysmyelinating with spastic paraparesis with or without dystonia.
• Molecular Mass: 69.2 kDa
• Sequence: MAPAPPPAASFSPSEVQRRLAAGACWVRRGARLYDLSSFVRHHPGGEQLLRARAGQDISADLDGPPHRHSANARRWLEQYYVGELRGEQQGSMENEPVALEETQKTDPAMEPRFKVVDWDKDLVDWRKPLLWQVGHLGEKYDEWVHQPVTRPIRLFHSDLIEGLSKTVWYSVPIIWVPLVLYLSWSYYRTFAQGNVRLFTSFTTEYTVAVPKSMFPGLFMLGTFLWSLIEYLIHRFLFHMKPPSDSYYLIMLHFVMHGQHHKAPFDGSRLVFPPVPASLVIGVFYLCMQLILPEAVGGTVFAGGLLGYVLYDMTHYYLHFGSPHKGSYLYSLKAHHVKHHFAHQKSGFGISTKLWDYCFHTLTPEKPHLKTQ
• Storagebuffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Applications: ELISA; WB
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• OfficialSymbol: FA2H

Gene Information

• Gene Name: FA2H fatty acid 2-hydroxylase [ Homo sapiens ]
• Synonyms: FA2H; fatty acid 2-hydroxylase; FAAH; FAH1; SCS7; SPG35; FAXDC1; fatty acid alpha-hydroxylase; fatty acid hydroxylase domain containing 1; spastic paraplegia 35 (autosomal recessive); EC 1.-.-.-; FLJ25287
• Gene ID: 79152
• mRNA Refseq: NM_024306
• Protein Refseq: NP_077282
• MIM: 611026
• UniProt ID: Q7L5A8
• Chromosome Location: 16q23
• Function: fatty acid alpha-hydroxylase activity; heme binding; iron ion binding