Recombinant Human FA2H, GST-tagged
| Cat.No. : | FA2H-893H |
| Product Overview : | Recombinant Human FA2H (1 a.a. - 372 a.a.) fused with GST-tag at N-terminal, was expressed in vitro wheat germ expression system. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a protein that catalyzes the synthesis of 2-hydroxysphingolipids, a subset of sphingolipids that contain 2-hydroxy fatty acids. Sphingolipids play roles in many cellular processes and their structural diversity arises from modification of the hydrophobic ceramide moiety, such as by 2-hydroxylation of the N-acyl chain, and the existence of many different head groups. Mutations in this gene have been associated with leukodystrophy dysmyelinating with spastic paraparesis with or without dystonia. |
| Molecular Mass : | 69.2 kDa |
| Sequence : | MAPAPPPAASFSPSEVQRRLAAGACWVRRGARLYDLSSFVRHHPGGEQLLRARAGQDISADLDGPPHRHSANARRWLEQYYVGELRGEQQGSMENEPVALEETQKTDPAMEPRFKVVDWDKDLVDWRKPLLWQVGHLGEKYDEWVHQPVTRPIRLFHSDLIEGLSKTVWYSVPIIWVPLVLYLSWSYYRTFAQGNVRLFTSFTTEYTVAVPKSMFPGLFMLGTFLWSLIEYLIHRFLFHMKPPSDSYYLIMLHFVMHGQHHKAPFDGSRLVFPPVPASLVIGVFYLCMQLILPEAVGGTVFAGGLLGYVLYDMTHYYLHFGSPHKGSYLYSLKAHHVKHHFAHQKSGFGISTKLWDYCFHTLTPEKPHLKTQ |
| Storagebuffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Applications : | ELISA; WB |
| Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| OfficialSymbol : | FA2H |
| Gene Name | FA2H fatty acid 2-hydroxylase [ Homo sapiens ] |
| Synonyms | FA2H; fatty acid 2-hydroxylase; FAAH; FAH1; SCS7; SPG35; FAXDC1; fatty acid alpha-hydroxylase; fatty acid hydroxylase domain containing 1; spastic paraplegia 35 (autosomal recessive); EC 1.-.-.-; FLJ25287 |
| Gene ID | 79152 |
| mRNA Refseq | NM_024306 |
| Protein Refseq | NP_077282 |
| MIM | 611026 |
| UniProt ID | Q7L5A8 |
| Chromosome Location | 16q23 |
| Function | fatty acid alpha-hydroxylase activity; heme binding; iron ion binding |
| ◆ Recombinant Proteins | ||
| FA2H-501C | Recombinant Cynomolgus FA2H Protein, His-tagged | +Inquiry |
| FA2H-1359R | Recombinant Rhesus Macaque FA2H Protein, His (Fc)-Avi-tagged | +Inquiry |
| FA2H-893H | Recombinant Human FA2H, GST-tagged | +Inquiry |
| RFL8392MF | Recombinant Full Length Macaca Fascicularis Fatty Acid 2-Hydroxylase(Fa2H) Protein, His-Tagged | +Inquiry |
| FA2H-2923M | Recombinant Mouse FA2H Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FA2H-6481HCL | Recombinant Human FA2H 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FA2H Products
Required fields are marked with *
My Review for All FA2H Products
Required fields are marked with *



