Recombinant Human FA2H, GST-tagged
Cat.No. : | FA2H-893H |
Product Overview : | Recombinant Human FA2H (1 a.a. - 372 a.a.) fused with GST-tag at N-terminal, was expressed in vitro wheat germ expression system. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a protein that catalyzes the synthesis of 2-hydroxysphingolipids, a subset of sphingolipids that contain 2-hydroxy fatty acids. Sphingolipids play roles in many cellular processes and their structural diversity arises from modification of the hydrophobic ceramide moiety, such as by 2-hydroxylation of the N-acyl chain, and the existence of many different head groups. Mutations in this gene have been associated with leukodystrophy dysmyelinating with spastic paraparesis with or without dystonia. |
Molecular Mass : | 69.2 kDa |
Sequence : | MAPAPPPAASFSPSEVQRRLAAGACWVRRGARLYDLSSFVRHHPGGEQLLRARAGQDISADLDGPPHRHSANARRWLEQYYVGELRGEQQGSMENEPVALEETQKTDPAMEPRFKVVDWDKDLVDWRKPLLWQVGHLGEKYDEWVHQPVTRPIRLFHSDLIEGLSKTVWYSVPIIWVPLVLYLSWSYYRTFAQGNVRLFTSFTTEYTVAVPKSMFPGLFMLGTFLWSLIEYLIHRFLFHMKPPSDSYYLIMLHFVMHGQHHKAPFDGSRLVFPPVPASLVIGVFYLCMQLILPEAVGGTVFAGGLLGYVLYDMTHYYLHFGSPHKGSYLYSLKAHHVKHHFAHQKSGFGISTKLWDYCFHTLTPEKPHLKTQ |
Storagebuffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
Applications : | ELISA; WB |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
OfficialSymbol : | FA2H |
Gene Name | FA2H fatty acid 2-hydroxylase [ Homo sapiens ] |
Synonyms | FA2H; fatty acid 2-hydroxylase; FAAH; FAH1; SCS7; SPG35; FAXDC1; fatty acid alpha-hydroxylase; fatty acid hydroxylase domain containing 1; spastic paraplegia 35 (autosomal recessive); EC 1.-.-.-; FLJ25287 |
Gene ID | 79152 |
mRNA Refseq | NM_024306 |
Protein Refseq | NP_077282 |
MIM | 611026 |
UniProt ID | Q7L5A8 |
Chromosome Location | 16q23 |
Function | fatty acid alpha-hydroxylase activity; heme binding; iron ion binding |
◆ Cell & Tissue Lysates | ||
FA2H-6481HCL | Recombinant Human FA2H 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FA2H Products
Required fields are marked with *
My Review for All FA2H Products
Required fields are marked with *
0
Inquiry Basket