Recombinant Human FLT3LG protein
Cat.No. : | FLT3LG-02H |
Product Overview : | Recombinant Human FLT3LG protein was expressed in Escherichia coli. |
Availability | June 15, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 155 |
Description : | Flt3-ligand (FL) is a recently identified hematopoietic cytokine whose activities are mediated by binding to the transmembrane glycoprotein Flt3. Flt3 was first discovered as a member of the class III subfamily of receptor tyrosine kinases (RTK) whose expression among hematopoietic cells was found to be restricted to highly enriched stem/progenitor cell populations. Additionally, class III RTKs include the receptors from SCF, M-CSF and PDGF. Not surprisingly, Flt3-ligand is also structurally related to M-CSF and SCF. All three cytokines have been shown to exist both as type I transmembrane proteins and as soluble proteins. The predominant human FL isoform is a transmembrane protein that can undergo proteolytic cleavage to generate a soluble form of the protein. An alternatively-spliced FL mRNA, encoding a soluble form of the human FL, has also been identified. FL is widely expressed in various human and mouse tissues. At the amino acid sequence level, human and mouse FL are approximately 72 % identical and the two proteins exhibit cross-species activity. FL has been shown to synergize with a wide variety of hematopoietic cytokines to stimulate the growth and differentiation of early hematopoietic progenitors. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.0. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human AML5 cells is less than 1.0 ng/ml, corresponding to a specific activity of > 1.0 × 10⁶ IU/mg. |
Molecular Mass : | Approximately 17.6 kDa, a single non-glycosylated polypeptide chain containing 155 amino acids. |
AA Sequence : | TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTA |
Endotoxin : | Less than 1 EU/μg of rHuFlt3-Ligand as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Publications : |
A new cancer immunotherapy via simultaneous DC‐mobilization and DC‐targeted IDO gene silencing using an immune‐stimulatory nanosystem (2018)
|
Gene Name | FLT3LG |
Official Symbol | FLT3LG |
Synonyms | FLT3LG; fms-related tyrosine kinase 3 ligand; flt3 ligand; FL; FLT3L; |
Gene ID | 2323 |
mRNA Refseq | NM_001204502 |
Protein Refseq | NP_001191431 |
MIM | 600007 |
UniProt ID | P49771 |
◆ Recombinant Proteins | ||
FLT3LG-151H | Active Recombinant Human FLT3LG | +Inquiry |
FLT3LG-1507H | Recombinant Human FLT3LG Protein, His&GST-tagged | +Inquiry |
FLT3LG-23H | Active Recombinant Human FLT3LG Protein, Pre-aliquoted | +Inquiry |
FLT3LG-276H | Active Recombinant Human Fms-related Tyrosine Kinase 3 Ligand, HIgG1 Fc-tagged, mutant | +Inquiry |
FLT3LG-100P | Recombinant Active Pig FLT3LG Protein, His-tagged(C-ter) | +Inquiry |
◆ Cell & Tissue Lysates | ||
FLT3LG-001HCL | Recombinant Human FLT3LG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FLT3LG Products
Required fields are marked with *
My Review for All FLT3LG Products
Required fields are marked with *
0
Inquiry Basket