Active Recombinant Human FLT3LG Protein

Cat.No. : FLT3LG-100H
Product Overview : Recombinant Human FLT3LG Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Description : Fms-related tyrosine kinase 3 ligand (FLT-3 ligand) is a growth factor that regulates hematopoietic cell proliferation. FLT-3 ligand signaling is transmitted through the fms-related tyrosine kinase 3 (FLT-3) receptor. FLT-3 ligand promotes the long-term expansion and differentiation of pro-B cells in the presence of interleukin 7 (IL-7) or in combination of IL-7 and interleukin 3 (IL-3). Human FLT-3 ligand is active on mouse cells.
Bio-activity : OCI-AML5 cell proliferation, ≤10 ng/mL; ≥1.0 x 10^5 units/mg
Molecular Mass : Monomer, 17.7 kDa (155 aa)
AA Sequence : MTQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPT
Endotoxin : ≤1 EUs/μg, Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, 50 mM NaCl, pH 7.5
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name FLT3LG fms-related tyrosine kinase 3 ligand [ Homo sapiens (human) ]
Official Symbol FLT3LG
Synonyms FLT3LG; fms-related tyrosine kinase 3 ligand; flt3 ligand; FL; FLT3L;
Gene ID 2323
mRNA Refseq NM_001204502
Protein Refseq NP_001191431
MIM 600007
UniProt ID P49771

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FLT3LG Products

Required fields are marked with *

My Review for All FLT3LG Products

Required fields are marked with *

0
cart-icon