"AGTR1" Related Products

Expand

Recombinant Human AGTR1, GST-tagged

Cat. No.: AGTR1-29H
Product Overview: Recombinant Human AGTR1 (250 a.a. - 359 a.a.) fused with GST-tag at N-terminal, was expressed in wheat germ.
Description: Angiotensin II is a potent vasopressor hormone and a primary regulator of aldosterone secretion. It is an important effector controlling blood pressure and volume in the cardiovascular system. It acts through at least two types of receptors. This gene encodes the type 1 receptor which is thought to mediate the major cardiovascular effects of angiotensin II. This gene may play a role in the generation of reperfusion arrhythmias following restoration of blood flow to ischemic or infarcted myocardium. It was previously thought that a related gene, denoted as AGTR1B, existed; however, it is now believed that there is only one type 1 receptor gene in humans. Multiple alternatively spliced transcript variants have been reported for this gene.
Source: wheat germ
Molecular Mass: 37.73 kDa
Sequence: FFSWIPHQIFTFLDVLIQLGIIRDCRIADIVDTAMPITICIAYFNNCLNPLFYGFLGKKFKRYFLQLLKYIPPKAKSHSNLSTKMSTLSYRHSDNVSSSTKKPAPCFEVE
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Applications: ELISA; WB
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
OfficialSymbol: AGTR1
Gene Name: AGTR1 angiotensin II receptor, type 1 [ Homo sapiens ]
Synonyms: AGTR1; angiotensin II receptor, type 1; AT1; AG2S; AT1B; AT1R; AT1AR; AT1BR; AT2R1; HAT1R; AGTR1A; AGTR1B; AT2R1A; AT2R1B; type-1 angiotensin II receptor; type-1B angiotensin II receptor; Angiotensin II type-1 receptor
Gene ID: 185
mRNA Refseq: NM_000685
Protein Refseq: NP_000676
MIM: 106165
UniProt ID: P30556
Chromosome Location: 3q24
Pathway: ACE Inhibitor Pathway; Angiopoietin receptor Tie2-mediated signaling; Arf6 signaling events
Function: G-protein coupled receptor activity; acetyltransferase activator activity; angiotensin type I receptor activity; angiotensin type I receptor activity; angiotensin type II receptor activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.