Recombinant Full Length Bovine Type-1 Angiotensin Ii Receptor(Agtr1) Protein, His-Tagged
Cat.No. : | RFL-20399BF |
Product Overview : | Recombinant Full Length Bovine Type-1 angiotensin II receptor(AGTR1) Protein (P25104) (1-359aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-359) |
Form : | Lyophilized powder |
AA Sequence : | MILNSSTEDGIKRIQDDCPKAGRHNYIFIMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLK TVASVFLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNYLCKIASASVSFNLYASVFLLT CLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIWLLAGLASLPTIIHRNVFFIENTNITVC AFHYESQNSTLPVGLGLTKNILGFLFPFLIILTSYTLIWKTLKKAYEIQKNKPRKDDIFK IILAIVLFFFFSWVPHQIFTFMDVLIQLGLIRDCKIEDIVDTAMPITICLAYFNNCLNPL FYGFLGKKFKKYFLQLLKYIPPKAKSHSNLSTKMSTLSYRPSENGNSSTKKPAPCIEVE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | AGTR1 |
Synonyms | AGTR1; Type-1 angiotensin II receptor; Angiotensin II type-1 receptor; AT1 |
UniProt ID | P25104 |
◆ Recombinant Proteins | ||
AGTR1-6713C | Recombinant Chicken AGTR1 | +Inquiry |
RFL-7711CF | Recombinant Full Length Dog Type-1 Angiotensin Ii Receptor(Agtr1) Protein, His-Tagged | +Inquiry |
AGTR1-784H | Recombinant Human AGTR1 protein, His&Myc-tagged | +Inquiry |
RFL29731CF | Recombinant Full Length Guinea Pig Type-1 Angiotensin Ii Receptor(Agtr1) Protein, His-Tagged | +Inquiry |
AGTR1-97H | Recombinant Human AGTR1 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
AGTR1-01HFL | Recombinant Full Length Human AGTR1 Protein, Flag tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AGTR1-8970HCL | Recombinant Human AGTR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AGTR1 Products
Required fields are marked with *
My Review for All AGTR1 Products
Required fields are marked with *