"TAT" Related Products

Expand
Expand
Expand

Recombinant Human TAT, GST-tagged

Cat. No.: TAT-2502H
Product Overview: Recombinant Human TAT (1 a.a. - 142 a.a.) fused with GST-tag at N-terminal, was expressed in wheat germ.
Description: This nuclear gene encodes a mitochondrial protein tyrosine aminotransferase which is present in the liver and catalyzes the conversion of L-tyrosine into p-hydroxyphenylpyruvate. Mutations in this gene cause tyrosinemia (type II, Richner-Hanhart syndrome), a disorder accompanied by major skin and corneal lesions, with possible mental retardation. A regulator gene for tyrosine aminotransferase is X-linked.
Source: wheat germ
Molecular Mass: 42.3 kDa
Sequence: MDPYMIQMSSKGNLPSILDVHVNVGGRSSVPGKMKGRKARWSVRPSDMAKKTFNPIRAIVDNMKVKPNPNKTMISLSIGELGTLLRGCHCPPLLSCSQAGWRRWQLGVSLSTEHGRITSWLLLCFPPIKRGPYCVWKPAYRP
Storagebuffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Applications: ELISA; WB
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
OfficialSymbol: TAT
Gene Name: TAT tyrosine aminotransferase [ Homo sapiens ]
Synonyms: TAT; tyrosine aminotransferase; tyrosine aminotransferase, cytosolic; L-tyrosine:2-oxoglutarate aminotransferase; EC 2.6.1.5
Gene ID: 6898
mRNA Refseq: NM_000353
Protein Refseq: NP_000344
MIM: 613018
UniProt ID: P17735
Chromosome Location: 16q22.1
Pathway: 4-hydroxybenzoate biosynthesis; 4-hydroxyphenylpyruvate biosynthesis; Cysteine and methionine metabolism; FOXA2 and FOXA3 transcription factor networks
Function: L-phenylalanine:2-oxoglutarate aminotransferase activity; L-tyrosine:2-oxoglutarate aminotransferase activity; amino acid binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.