Recombinant Human CRLF1, GST-tagged

• Cat.No.: CRLF1-311H
• Product Overview: Recombinant Human CRLF1 encoding Human CRLF1 partial ORF ( NP_004741, 135 aa - 230 aa),fused with GST-tag at N-terminal, was expressed in Wheat germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the cytokine type I receptor family. The protein forms a secreted complex with cardiotrophin-like cytokine factor 1 and acts on cells expressing ciliary neurotrophic factor receptors. The complex can promote survival of neuronal cells. Mutations in this gene result in Crisponi syndrome and cold-induced sweating syndrome.
• Molecular Mass: 36.3 kDa
• AA Sequence: PEKPVNISCWSKNMKDLTCRWTPGAHGETFLHTNYSLKYKLRWYGQDNTCEEYHTVGPHSCHIPKDLALFTPYEIWVEATNRLGSARSDVLTLDIL
• Applications: WB; ELISA
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH8.0 in the elution buffer.

Gene Information

• Gene Name: CRLF1 cytokine receptor-like factor 1 [ Homo sapiens ]
• Official Symbol: CRLF1
• Synonyms: CRLF1; cytokine receptor-like factor 1; CISS; CISS1; CLF; CLF 1; cold induced sweating syndrome; cytokine-like factor 1; class I cytokine receptor; cytokine type 1 receptor CRLP-1; NR6; CLF-1; zcytor5
• Gene ID: 9244
• mRNA Refseq: NM_004750
• Protein Refseq: NP_004741
• MIM: 604237
• UniProt ID: O75462
• Chromosome Location: 19p12
• Function: contributes_to ciliary neurotrophic factor receptor binding; contributes_to cytokine activity; cytokine binding; protein binding; protein heterodimerization activity; receptor activity