"CRLF1" Related Products

Expand
Expand

Recombinant Human CRLF1, GST-tagged

Cat.No.: CRLF1-311H
Product Overview: Recombinant Human CRLF1 encoding Human CRLF1 partial ORF ( NP_004741, 135 aa - 230 aa),fused with GST-tag at N-terminal, was expressed in Wheat germ.
Description: This gene encodes a member of the cytokine type I receptor family. The protein forms a secreted complex with cardiotrophin-like cytokine factor 1 and acts on cells expressing ciliary neurotrophic factor receptors. The complex can promote survival of neuronal cells. Mutations in this gene result in Crisponi syndrome and cold-induced sweating syndrome.
Source: Wheat germ
Species: Human
Tag: GST
Molecular Mass: 36.3 kDa
AA Sequence: PEKPVNISCWSKNMKDLTCRWTPGAHGETFLHTNYSLKYKLRWYGQDNTCEEYHTVGPHSCHIPKDLALFTPYEIWVEATNRLGSARSDVLTLDIL
Applications: WB; ELISA
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH8.0 in the elution buffer.
Gene Name: CRLF1 cytokine receptor-like factor 1 [ Homo sapiens ]
Official Symbol: CRLF1
Synonyms: CRLF1; cytokine receptor-like factor 1; CISS; CISS1; CLF; CLF 1; cold induced sweating syndrome; cytokine-like factor 1; class I cytokine receptor; cytokine type 1 receptor CRLP-1; NR6; CLF-1; zcytor5;
Gene ID: 9244
mRNA Refseq: NM_004750
Protein Refseq: NP_004741
MIM: 604237
UniProt ID: O75462
Chromosome Location: 19p12
Function: contributes_to ciliary neurotrophic factor receptor binding; contributes_to cytokine activity; cytokine binding; protein binding; protein heterodimerization activity; receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.