Recombinant Human CRLF1, GST-tagged
Cat.No. : | CRLF1-319H |
Product Overview : | Recombinant Human CRLF1 encoding Human CRLF1 full-length ORF ( NP_004741.1, 1 aa - 422 aa),fused with GST-tag at N-terminal, was expressed in Wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the cytokine type I receptor family. The protein forms a secreted complex with cardiotrophin-like cytokine factor 1 and acts on cells expressing ciliary neurotrophic factor receptors. The complex can promote survival of neuronal cells. Mutations in this gene result in Crisponi syndrome and cold-induced sweating syndrome. |
Molecular Mass : | 72.7 kDa |
AA Sequence : | MPAGRRGPAAQSARRPPPLLPLLLLLCVLGAPRAGSGAHTAVISPQDPTLLIGSSLLATCSVHGDPPGATAEGLYWTLNGRRLPPELSRVLNASTLALALANLNGSRQRSGDNLVCHARDGSILAGSCLYVGLPPEKPVNISCWSKNMKDLTCRWTPGAHGETFLHTNYSLKYKLRWYGQDNTCEEYHTVGPHSCHIPKDLALFTPYEIWVEATNRLGSARSDVLTLDILDVVTTDPPPDVHVSRVGGLEDQLSVRWVSPPALKDFLFQAKYQIRYRVEDSVDWKVVDDVSNQTSCRLAGLKPGTVYFVQVRCNPFGIYGSKKAGIWSEWSHPTAASTPRSERPGPGGGACEPRGGEPSSGPVRRELKQFLGWLKKHAYCSNLSFRLYDQWRAWMQKSHKTRNQDEGILPSGRRGTARGPAR |
Applications : | WB; ELISA |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH8.0 in the elution buffer. |
Gene Name | CRLF1 cytokine receptor-like factor 1 [ Homo sapiens ] |
Official Symbol | CRLF1 |
Synonyms | CRLF1; cytokine receptor-like factor 1; CISS; CISS1; CLF; CLF 1; cold induced sweating syndrome; cytokine-like factor 1; class I cytokine receptor; cytokine type 1 receptor CRLP-1; NR6; CLF-1; zcytor5; |
Gene ID | 9244 |
mRNA Refseq | NM_004750 |
Protein Refseq | NP_004741 |
MIM | 604237 |
UniProt ID | O75462 |
Chromosome Location | 19p12 |
Function | contributes_to ciliary neurotrophic factor receptor binding; contributes_to cytokine activity; cytokine binding; protein binding; protein heterodimerization activity; receptor activity; |
◆ Recombinant Proteins | ||
CRLF1-1428H | Recombinant Human CRLF1 protein, His & GST-tagged | +Inquiry |
Crlf1-1429M | Recombinant Mouse Crlf1 protein, His & T7-tagged | +Inquiry |
CRLF1-5878H | Recombinant Human CRLF1 protein, His&Myc-tagged | +Inquiry |
CRLF1-2145H | Recombinant Human CRLF1, Fc-tagged | +Inquiry |
CRLF1-1985M | Recombinant Mouse CRLF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRLF1-404HCL | Recombinant Human CRLF1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CRLF1 Products
Required fields are marked with *
My Review for All CRLF1 Products
Required fields are marked with *