Recombinant Human ESCO2, GST-tagged
Cat.No. : | ESCO2-01H |
Product Overview : | Recombinant human ESCO2 protein, fused to GST-tag, was expressed in E.coli and purified by using traditional GST-affinity column. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 2-352a.a. |
Description : | This gene encodes a protein that may have acetyltransferase activity and may be required for the establishment of sister chromatid cohesion during the S phase of mitosis. Mutations in this gene have been associated with Roberts syndrome. |
Molecular Mass : | 66kDa |
AA Sequence : | MAALTPRKRKQDSLKCDSLLHFTENLFPSPNKKHCFYQNSDKNEENLHCSQQEHFVLSALKTTEINRLPSANQGS PFKSALSTVSFYNQNKWYLNPLERKLIKESRSTCLKTNDEDKSFPIVTEKMQGKPVCSKKNNKKPQKSLTAKYQP KYRHIKPVSRNSRNSKQNRVIYKPIVEKENNCHSAENNSNAPRVLSQKIKPQVTLQGGAAFFVRKKSSLRKSSLE NEPSLGRTQKSKSEVIEDSDVETVSEKKTFATRQVPKCLVLEEKLKIGLLSASSKNKEKLIKDSSDDRVSSKEHK VDKNEAFSSEDSLGENKTISPKSTVYPIFSASSVNSKRSLGEEQFSVGSVNF |
Applications : | SDS-PAGE |
Gene Name | ESCO2 establishment of cohesion 1 homolog 2 (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | ESCO2 |
Synonyms | ESCO2; establishment of cohesion 1 homolog 2 (S. cerevisiae); RBS, Roberts syndrome; N-acetyltransferase ESCO2; EFO2; ECO1 homolog 2; RBS; 2410004I17Rik; |
Gene ID | 157570 |
mRNA Refseq | NM_001017420 |
Protein Refseq | NP_001017420 |
MIM | 609353 |
UniProt ID | Q56NI9 |
Chromosome Location | 8p21.1 |
Function | metal ion binding; transferase activity, transferring acyl groups; |
◆ Recombinant Proteins | ||
ESCO2-01H | Recombinant Human ESCO2, GST-tagged | +Inquiry |
ESCO2-2862M | Recombinant Mouse ESCO2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ESCO2-4699HF | Recombinant Full Length Human ESCO2 Protein, GST-tagged | +Inquiry |
ESCO2-1159Z | Recombinant Zebrafish ESCO2 | +Inquiry |
ESCO2-5319M | Recombinant Mouse ESCO2 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ESCO2 Products
Required fields are marked with *
My Review for All ESCO2 Products
Required fields are marked with *