"PGAM1" Related Products

Expand
Expand
Expand

Recombinant Human PGAM1, GST-tagged

Cat. No.: PGAM1-2487TH
Product Overview: Recombinant Human PGAM1 (1 a.a. - 254 a.a.) fused with GST-tag at N-terminal, was expressed in wheat germ.
Description: Phosphoglyceric acid mutase (EC 2.7.5.3) is widely distributed in mammalian tissues where it catalyzes the reversible reaction of 3-phosphoglycerate (3-PGA) to 2-phosphoglycerate (2-PGA) in the glycolytic pathway.
Source: wheat germ
Molecular Mass: 53.68 kDa
Sequence: MAAYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVPPPPMEPDHPFYSNISKDRRYADLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVRKAMEAVAAQGKAKK
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Applications: ELISA; WB
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
OfficialSymbol: PGAM1
Gene Name: PGAM1 phosphoglycerate mutase 1 (brain) [ Homo sapiens ]
Synonyms: PGAM1; phosphoglycerate mutase 1 (brain); PGAMA; PGAM-B; phosphoglycerate mutase 1; BPG-dependent PGAM 1; phosphoglycerate mutase isozyme B; Phosphoglycerate mutase A; nonmuscle form; EC 3.1.3.13; EC 5.4.2.1; EC 5.4.2.4
Gene ID: 5223
mRNA Refseq: NM_002629
Protein Refseq: NP_002620
MIM: 172250
UniProt ID: P18669
Chromosome Location: 10q25.3
Pathway: Gluconeogenesis; Gluconeogenesis, oxaloacetate => fructose-6P; Glycine, serine and threonine metabolism
Function: bisphosphoglycerate 2-phosphatase activity; bisphosphoglycerate mutase activity; hydrolase activity; isomerase activity; phosphoglycerate mutase activity

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.