Recombinant Human ABCC6 protein, His-tagged
| Cat.No. : | ABCC6-9219H |
| Product Overview : | Recombinant Human ABCC6 protein(1219-1503 aa), fused with N-terminal His tag, was expressed in E. coli. |
| Availability | September 07, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1219-1503 aa |
| Tag : | N-His |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | VVRNWTDLENSIVSVERMQDYAWTPKEAPWRLPTCAAQPPWPQGGQIEFRDFGLRYRPELPLAVQGVSFKIHAGEKVGIVGRTGAGKSSLASGLLRLQEAAEGGIWIDGVPIAHVGLHTLRSRISIIPQDPILFPGSLRMNLDLLQEHSDEAIWAALETVQLKALVASLPGQLQYKCADRGEDLSVGQKQLLCLARALLRKTQILILDEATAAVDPGTELQMQAMLGSWFAQCTVLLIAHRLRSVMDCARVLVMDKGQVAESGSPAQLLAQKGLFYRLAQESGLV |
| Gene Name | ABCC6 ATP-binding cassette, sub-family C (CFTR/MRP), member 6 [ Homo sapiens ] |
| Official Symbol | ABCC6 |
| Synonyms | ABCC6; ATP-binding cassette, sub-family C (CFTR/MRP), member 6; ARA, pseudoxanthoma elasticum , PXE; URG7 protein; multidrug resistance-associated protein 6; EST349056; MLP1; MRP6; URG7; multidrug resistance-associated protein 6; MOAT-E; ATP-binding cassette sub-family C member 6; multi-specific organic anion transporter E; anthracycline resistance-associated protein; ARA; PXE; PXE1; ABC34; GACI2; MOATE; |
| Gene ID | 368 |
| mRNA Refseq | NM_001079528 |
| Protein Refseq | NP_001072996 |
| MIM | 603234 |
| UniProt ID | O95255 |
| ◆ Recombinant Proteins | ||
| Abcc6-8121R | Recombinant Rat Abcc6 protein, His & T7-tagged | +Inquiry |
| Abcc6-8120M | Recombinant Mouse Abcc6 protein, His & T7-tagged | +Inquiry |
| ABCC6-052H | Recombinant Human ABCC6 Protein, GST-Tagged | +Inquiry |
| ABCC6-2403H | Recombinant Human ABCC6 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ABCC6-633H | Recombinant Human ABCC6 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ABCC6-6HCL | Recombinant Human ABCC6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ABCC6 Products
Required fields are marked with *
My Review for All ABCC6 Products
Required fields are marked with *
