Recombinant Human ABCC6 Protein, GST-Tagged
| Cat.No. : | ABCC6-052H |
| Product Overview : | Human ABCC6 partial ORF ( NP_001162, 831 a.a. - 930 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). The encoded protein, a member of the MRP subfamily, is involved in multi-drug resistance. Mutations in this gene cause pseudoxanthoma elasticum. Alternatively spliced transcript variants that encode different proteins have been described for this gene. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | IAEMGSYQELLQRKGALVCLLDQARQPGDRGEGETEPGTSTKDPRGTSAGRRPELRRERSIKSVPEKDRTTSEAQTEVPLDDPDRAGWPAGKDSIQYGRV |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ABCC6 ATP-binding cassette, sub-family C (CFTR/MRP), member 6 [ Homo sapiens ] |
| Official Symbol | ABCC6 |
| Synonyms | ABCC6; ATP-binding cassette, sub-family C (CFTR/MRP), member 6; ARA, pseudoxanthoma elasticum , PXE; URG7 protein; multidrug resistance-associated protein 6; EST349056; MLP1; MRP6; URG7; multidrug resistance-associated protein 6; MOAT-E; ATP-binding cassette sub-family C member 6; multi-specific organic anion transporter E; anthracycline resistance-associated protein; ARA; PXE; PXE1; ABC34; GACI2; MOATE; |
| Gene ID | 368 |
| mRNA Refseq | NM_001079528 |
| Protein Refseq | NP_001072996 |
| MIM | 603234 |
| UniProt ID | O95255 |
| ◆ Recombinant Proteins | ||
| ABCC6-1104M | Recombinant Mouse ABCC6 Protein | +Inquiry |
| ABCC6-633H | Recombinant Human ABCC6 Protein, His-tagged | +Inquiry |
| ABCC6-051H | Recombinant Human ABCC6 Protein, GST-Tagged | +Inquiry |
| Abcc6-8121R | Recombinant Rat Abcc6 protein, His & T7-tagged | +Inquiry |
| ABCC6-62R | Recombinant Rat ABCC6 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ABCC6-6HCL | Recombinant Human ABCC6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ABCC6 Products
Required fields are marked with *
My Review for All ABCC6 Products
Required fields are marked with *
