Recombinant Human ABCC6 Protein, GST-Tagged

Cat.No. : ABCC6-052H
Product Overview : Human ABCC6 partial ORF ( NP_001162, 831 a.a. - 930 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). The encoded protein, a member of the MRP subfamily, is involved in multi-drug resistance. Mutations in this gene cause pseudoxanthoma elasticum. Alternatively spliced transcript variants that encode different proteins have been described for this gene. [provided by RefSeq, Jul 2008]
Molecular Mass : 36.74 kDa
AA Sequence : IAEMGSYQELLQRKGALVCLLDQARQPGDRGEGETEPGTSTKDPRGTSAGRRPELRRERSIKSVPEKDRTTSEAQTEVPLDDPDRAGWPAGKDSIQYGRV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ABCC6 ATP-binding cassette, sub-family C (CFTR/MRP), member 6 [ Homo sapiens ]
Official Symbol ABCC6
Synonyms ABCC6; ATP-binding cassette, sub-family C (CFTR/MRP), member 6; ARA, pseudoxanthoma elasticum , PXE; URG7 protein; multidrug resistance-associated protein 6; EST349056; MLP1; MRP6; URG7; multidrug resistance-associated protein 6; MOAT-E; ATP-binding cassette sub-family C member 6; multi-specific organic anion transporter E; anthracycline resistance-associated protein; ARA; PXE; PXE1; ABC34; GACI2; MOATE;
Gene ID 368
mRNA Refseq NM_001079528
Protein Refseq NP_001072996
MIM 603234
UniProt ID O95255

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ABCC6 Products

Required fields are marked with *

My Review for All ABCC6 Products

Required fields are marked with *

0
cart-icon
0
compare icon