Recombinant Human ACTN3 protein, GST-tagged

• Cat.No.: ACTN3-9341H
• Product Overview: Recombinant Human ACTN3 protein(577-624 aa), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 577-624 aa
• Tag: N-GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
• AA Sequence: RERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINTKWDMVRKL

Gene Information

• Gene Name: ACTN3 actinin, alpha 3 [ Homo sapiens ]
• Official Symbol: ACTN3
• Synonyms: ACTN3; actinin, alpha 3; alpha-actinin-3; F-actin cross-linking protein; alpha-actinin skeletal muscle; MGC117002; MGC117005
• Gene ID: 89
• mRNA Refseq: NM_001104
• Protein Refseq: NP_001095
• UniProt ID: Q08043