Recombinant Human ACTN3 protein, GST-tagged
| Cat.No. : | ACTN3-9341H |
| Product Overview : | Recombinant Human ACTN3 protein(577-624 aa), fused with N-terminal GST tag, was expressed in E. coli. |
| Availability | November 23, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 577-624 aa |
| Tag : | N-GST |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | RERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINTKWDMVRKL |
| Gene Name | ACTN3 actinin, alpha 3 [ Homo sapiens ] |
| Official Symbol | ACTN3 |
| Synonyms | ACTN3; actinin, alpha 3; alpha-actinin-3; F-actin cross-linking protein; alpha-actinin skeletal muscle; MGC117002; MGC117005; |
| Gene ID | 89 |
| mRNA Refseq | NM_001104 |
| Protein Refseq | NP_001095 |
| UniProt ID | Q08043 |
| ◆ Recombinant Proteins | ||
| Actn3-3335M | Recombinant Mouse Actn3, His-tagged | +Inquiry |
| ACTN3-9342H | Recombinant Human ACTN3 protein | +Inquiry |
| ACTN3-9343H | Recombinant Human ACTN3 protein, His/T7-tagged | +Inquiry |
| ACTN3-9341H | Recombinant Human ACTN3 protein, GST-tagged | +Inquiry |
| ◆ Native Proteins | ||
| ACTN3-3280C | Native Chicken ACTN3 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACTN3 Products
Required fields are marked with *
My Review for All ACTN3 Products
Required fields are marked with *
