"NGF" Related Products

Expand
Expand

Recombinant Human Pro-Nerve Growth Factor

Cat. No.: NGF-11H
Product Overview: Pro NGF is the pro-form of the neurotrophin nerve growth factor. Like the mature protein pro NGF is characterized by the cysteine knot motif consisting of three cysteine bridges. The protein predominantly exists as a non-covalently linked homodimer. Pro-Nerve Growth Factor Human Recombinant produced in E.Coli is a non-glycosylated, polypeptide chain containing 222 amino acids and having a molecular mass of 49,738 Dalton. The Pro NGF is purified by proprietary chromatographic techniques.
Synonyms: Human Pro-NGF; ProNGF; Pro-Nerve Growth Factor.
Source: Escherichia Coli.
Physical Appearance: Sterile Filtered clear solution.
Amino acid sequence: MEPHSESNVPAGHTIPQVHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKK RRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSV SVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNS YCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAR.
Purity: Greater than 98.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Formulation: The sterile protein solution 1.2mg/ml contains 50mM sodium phosphate buffer pH 7.2. 150mM sodium chloride.
Biological Activity: The activity of the protein can by measured by its stimulating effect on the proliferation of TF1 cells (Chevalier et al. 1994 Blood 83, 1479-85). EC50 130 ± 30 pM (TF1 cell assay).
Storage: Pro-Nerve Growth Factor although stable at 15℃ for a week, should be stored at -20℃. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.