"GDF5" Related Products

Expand

Recombinant Human GDF5 protein

Cat.No. : GDF5-34H
Product Overview : Recombinant Human GDF5 protein was expressed in Escherichia coli.
Description : Growth/differentiation factors (GDF-1 to GDF-15) are members of the BMP family of TGF-beta superfamily proteins. They are produced as inactive preproproteins which are then cleaved and assembled into active secreted homodimers. GDF dimers are disulfide-linked with the exception of GDF-3 and -9. GDF proteins are important during embryonic development, particularly in the skeletal, nervous, and muscular systems.
Source : E.coli
Species : Human
Form : Lyophilized from a 0.2μm filtered concentrated solution in 30 % Acetonitrile and 0.1 % TFA.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by inducing alkaline phosphatase production of murine ATDC5 cells is less than 1.0 μg/ml, corresponding to a specific activity of > 1000 IU/mg.
Molecular Mass : Approximately 27.1 kDa, a disulfide-linked homodimeric protein containing two 120 amino acids.
Protein length : 120
AA Sequence : APLATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR
Endotoxin : Less than 0.1 EU/µg of rHuGDF-5/BMP-14 as determined by LAL method.
Purity : >95% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name : GDF5
Official Symbol : GDF5
Synonyms : GDF5; growth differentiation factor 5; growth/differentiation factor 5; BMP14; cartilage derived morphogenetic protein 1; CDMP1; GDF-5; CDMP-1; radotermin; cartilage-derived morphogenetic protein-1; OS5; LAP4; SYNS2;
Gene ID : 8200
mRNA Refseq : NM_000557
Protein Refseq : NP_000548
MIM : 601146
UniProt ID : P43026

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.