Recombinant Active Human Gdf5 Protein, His-tagged(C-ter)

Cat.No. : GDF5-105H
Product Overview : Recombinant Active Human Gdf5 Protein with His tag (C-ter) was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. This protein regulates the development of numerous tissue and cell types, including cartilage, joints, brown fat, teeth, and the growth of neuronal axons and dendrites. Mutations in this gene are associated with acromesomelic dysplasia, brachydactyly, chondrodysplasia, multiple synostoses syndrome, proximal symphalangism, and susceptibility to osteoarthritis.
Form : Powder
Bio-activity : Determined by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED50 for this effect is < 14 ng/mL.
AA Sequence : MAPLATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR
Endotoxin : Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test.
Purity : > 98% (by SDS-PAGE)
Applications : SDS-PAGE
Notes : For laboratory research only, not for drug, diagnostic or other use.
Storage : Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening.
Storage Buffer : 20 mM Sodium citrate (pH 3.5) and 0.2 M NaCl.
Reconstitution : It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely.
Gene Name GDF5 growth differentiation factor 5 [ Homo sapiens ]
Official Symbol GDF5
Synonyms GDF5; growth differentiation factor 5; growth/differentiation factor 5; BMP14; cartilage derived morphogenetic protein 1; CDMP1; GDF-5; CDMP-1; radotermin; cartilage-derived morphogenetic protein-1; OS5; LAP4; SYNS2;
Gene ID 8200
mRNA Refseq NM_000557
Protein Refseq NP_000548
MIM 601146
UniProt ID P43026

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Gdf5 Products

Required fields are marked with *

My Review for All Gdf5 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon