Recombinant Active Human Gdf5 Protein, His-tagged(C-ter)
Cat.No. : | GDF5-105H |
Product Overview : | Recombinant Active Human Gdf5 Protein with His tag (C-ter) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. This protein regulates the development of numerous tissue and cell types, including cartilage, joints, brown fat, teeth, and the growth of neuronal axons and dendrites. Mutations in this gene are associated with acromesomelic dysplasia, brachydactyly, chondrodysplasia, multiple synostoses syndrome, proximal symphalangism, and susceptibility to osteoarthritis. |
Form : | Powder |
Bio-activity : | Determined by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED50 for this effect is < 14 ng/mL. |
AA Sequence : | MAPLATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR |
Endotoxin : | Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test. |
Purity : | > 98% (by SDS-PAGE) |
Applications : | SDS-PAGE |
Notes : | For laboratory research only, not for drug, diagnostic or other use. |
Storage : | Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. |
Storage Buffer : | 20 mM Sodium citrate (pH 3.5) and 0.2 M NaCl. |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely. |
Gene Name | GDF5 growth differentiation factor 5 [ Homo sapiens ] |
Official Symbol | GDF5 |
Synonyms | GDF5; growth differentiation factor 5; growth/differentiation factor 5; BMP14; cartilage derived morphogenetic protein 1; CDMP1; GDF-5; CDMP-1; radotermin; cartilage-derived morphogenetic protein-1; OS5; LAP4; SYNS2; |
Gene ID | 8200 |
mRNA Refseq | NM_000557 |
Protein Refseq | NP_000548 |
MIM | 601146 |
UniProt ID | P43026 |
◆ Recombinant Proteins | ||
GDF5-27678TH | Recombinant Human GDF5, His-tagged | +Inquiry |
GDF5-34H | Recombinant Human GDF5 protein | +Inquiry |
Gdf5-720M | Active Recombinant Mouse Growth Differentiation Factor 5 | +Inquiry |
GDF5-4827H | Recombinant Human GDF5 Protein, GST-tagged | +Inquiry |
GDF5-27470TH | Recombinant Human GDF5 | +Inquiry |
◆ Cell & Tissue Lysates | ||
GDF5-5968HCL | Recombinant Human GDF5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Gdf5 Products
Required fields are marked with *
My Review for All Gdf5 Products
Required fields are marked with *
0
Inquiry Basket