Active Recombinant Mouse Gdf5 Protein

Cat.No. : Gdf5-065M
Product Overview : Purified recombinant protein of Mouse growth differentiation factor 5 (Gdf5) without tag was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Description : This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. This protein regulates the development of numerous tissue and cell types, including cartilage, joints, brown fat, teeth, and the growth of neuronal axons and dendrites. Mice with a mutation in this gene exhibit enhanced tooth enamel formation.
Bio-activity : Determined by its ability to induce alkaline phosphatase production by ATDC-5 cells. The expected ED50 for this effect is 1.0-2.0 ug/ml.
Molecular Mass : 27 kDa
AA Sequence : APLANRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR
Endotoxin : Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Purity : >95%, as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Storage : Store at -80 centigrade.
Storage Buffer : Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Reconstitution : Resuspend the protein in the desired concentration in proper buffer.
Gene Name Gdf5 growth differentiation factor 5 [ Mus musculus (house mouse) ]
Official Symbol Gdf5
Synonyms Gdf5; growth differentiation factor 5; bp; brp; BMP-14; Cdmp-1; growth/differentiation factor 5; bone morphogenetic protein 14; cartilage-derived morphogenetic protein-1
Gene ID 14563
mRNA Refseq NM_008109
Protein Refseq NP_032135
UniProt ID P43027

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Gdf5 Products

Required fields are marked with *

My Review for All Gdf5 Products

Required fields are marked with *

0
cart-icon