| Species : |
Mouse |
| Source : |
E.coli |
| Description : |
This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. This protein regulates the development of numerous tissue and cell types, including cartilage, joints, brown fat, teeth, and the growth of neuronal axons and dendrites. Mice with a mutation in this gene exhibit enhanced tooth enamel formation. |
| Bio-activity : |
Determined by its ability to induce alkaline phosphatase production by ATDC-5 cells. The expected ED50 for this effect is 1.0-2.0 ug/ml. |
| Molecular Mass : |
27 kDa |
| AA Sequence : |
APLANRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR |
| Endotoxin : |
Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
| Purity : |
>95%, as determined by SDS-PAGE and Coomassie blue staining |
| Stability : |
Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
| Storage : |
Store at -80 centigrade. |
| Storage Buffer : |
Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
| Reconstitution : |
Resuspend the protein in the desired concentration in proper buffer. |