Active Recombinant Mouse Gdf5 Protein

• Cat.No.: Gdf5-065M
• Product Overview: Purified recombinant protein of Mouse growth differentiation factor 5 (Gdf5) without tag was expressed in E.coli.

Specification

• Species: Mouse
• Source: E.coli
• Description: This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. This protein regulates the development of numerous tissue and cell types, including cartilage, joints, brown fat, teeth, and the growth of neuronal axons and dendrites. Mice with a mutation in this gene exhibit enhanced tooth enamel formation.
• Bio-activity: Determined by its ability to induce alkaline phosphatase production by ATDC-5 cells. The expected ED50 for this effect is 1.0-2.0 ug/ml.
• Molecular Mass: 27 kDa
• AA Sequence: APLANRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Purity: >95%, as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.
• Storage: Store at -80 centigrade.
• Storage Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Reconstitution: Resuspend the protein in the desired concentration in proper buffer.

Gene Information

• Gene Name: Gdf5 growth differentiation factor 5 [ Mus musculus (house mouse) ]
• Official Symbol: Gdf5
• Synonyms: Gdf5; growth differentiation factor 5; bp; brp; BMP-14; Cdmp-1; growth/differentiation factor 5; bone morphogenetic protein 14; cartilage-derived morphogenetic protein-1
• Gene ID: 14563
• mRNA Refseq: NM_008109
• Protein Refseq: NP_032135
• UniProt ID: P43027