Recombinant Human GADD45A protein, GST-tagged
Cat.No. : | GADD45A-13109H |
Product Overview : | Recombinant Human GADD45A protein(5-165 aa), fused with N-terminal GST tag, was expressed in E. coli. |
Availability | September 18, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 5-165 aa |
Tag : | N-GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | EFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLAADEDDDRDVALQIHFTLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER |
Gene Name | GADD45A growth arrest and DNA-damage-inducible, alpha [ Homo sapiens ] |
Official Symbol | GADD45A |
Synonyms | GADD45A; growth arrest and DNA-damage-inducible, alpha; DDIT1; growth arrest and DNA damage-inducible protein GADD45 alpha; GADD45; DDIT-1; DNA damage-inducible transcript-1; DNA-damage-inducible transcript 1; DNA damage-inducible transcript 1 protein; growth arrest and DNA-damage-inducible 45 alpha; |
Gene ID | 1647 |
mRNA Refseq | NM_001199741 |
Protein Refseq | NP_001186670 |
MIM | 126335 |
UniProt ID | P24522 |
◆ Recombinant Proteins | ||
GADD45A-3880H | Recombinant Human GADD45A protein, His&GST-tagged | +Inquiry |
GADD45A-5206HF | Recombinant Full Length Human GADD45A Protein, GST-tagged | +Inquiry |
GADD45A-3470C | Recombinant Chicken GADD45A | +Inquiry |
GADD45A-3482H | Recombinant Human GADD45A protein, His-tagged | +Inquiry |
Gadd45a-1558R | Recombinant Rat Gadd45a Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GADD45A-575HCL | Recombinant Human GADD45A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GADD45A Products
Required fields are marked with *
My Review for All GADD45A Products
Required fields are marked with *