Recombinant Human HBXIP protein, GST-tagged
| Cat.No. : | HBXIP-13689H |
| Product Overview : | Recombinant Human HBXIP protein(1-173 aa), fused with N-terminal GST tag, was expressed in E.coli. |
| Availability | June 16, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-173 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | MEPGAGHLDGHRAGSPSLRQALCDGSAVMFSSKERGRCTVINFVPLEAPLRSTPRSRQVTEACGGEGRAVPLGSEPEWSVGGMEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSDPTDIPVVCLESDNGNIMIQKHDGITVAVHKMAS |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | HBXIP hepatitis B virus x interacting protein [ Homo sapiens ] |
| Official Symbol | HBXIP |
| Synonyms | HBXIP; hepatitis B virus x interacting protein; hepatitis B virus X-interacting protein; HBx interacting protein; hepatitis B virus x interacting protein (9.6kD); MGC71071; XIP; HBx-interacting protein; HBV X-interacting protein; hepatitis B virus x-interacting protein (9.6kD); |
| Gene ID | 10542 |
| mRNA Refseq | NM_006402 |
| Protein Refseq | NP_006393 |
| MIM | 608521 |
| UniProt ID | O43504 |
| ◆ Recombinant Proteins | ||
| HBXIP-3501HF | Recombinant Full Length Human HBXIP Protein, GST-tagged | +Inquiry |
| HBXIP-13689H | Recombinant Human HBXIP protein, GST-tagged | +Inquiry |
| HBXIP-4063C | Recombinant Chicken HBXIP | +Inquiry |
| HBXIP-3022H | Recombinant Human HBXIP protein, GST-tagged | +Inquiry |
| HBXIP-6961H | Recombinant Human Hepatitis B Virus X Interacting Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HBXIP-5616HCL | Recombinant Human HBXIP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HBXIP Products
Required fields are marked with *
My Review for All HBXIP Products
Required fields are marked with *
