Recombinant Human ADIPOR1, GST-tagged
| Cat.No. : | ADIPOR1-625H |
| Product Overview : | Human ADIPOR1 full-length ORF ( NP_057083.2, 1 a.a. - 375 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a protein which acts as a receptor for adiponectin, a hormone secreted by adipocytes which regulates fatty acid catabolism and glucose levels. Binding of adiponectin to the encoded protein results in activation of an AMP-activated kinase signaling pathway which affects levels of fatty acid oxidation and insulin sensitivity. A pseudogene of this gene is located on chromosome 14. |
| Molecular Mass : | 69 kDa |
| AA Sequence : | MSSHKGSVVAQGNGAPASNREADTVELAELGPLLEEKGKRVIANPPKAEEEQTCPVPQEEEEEVRVLTLPLQAHH AMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGFVLFLF LGILTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLY YSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQM GWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVHFYGVSNLQEFRYGLEGGCTDDTLL |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot; Antibody Production; Protein Array |
| Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ADIPOR1 adiponectin receptor 1 [ Homo sapiens (human) ] |
| Official Symbol | ADIPOR1 |
| Synonyms | ADIPOR1; CGI45; PAQR1; ACDCR1; CGI-45; TESBP1A; adiponectin receptor 1; progestin and adipoQ receptor family member I |
| Gene ID | 51094 |
| mRNA Refseq | NM_015999 |
| Protein Refseq | NP_057083 |
| MIM | 607945 |
| UniProt ID | Q96A54 |
| Chromosome Location | 1q32.1 |
| Pathway | AMPK signaling; Adipocytokine signaling pathway |
| Function | hormone binding; identical protein binding; protein heterodimerization activity |
| ◆ Recombinant Proteins | ||
| ADIPOR1-234H | Recombinant Human ADIPOR1 Transmembrane protein | +Inquiry |
| ADIPOR1-248R | Recombinant Rhesus monkey ADIPOR1 Protein, His-tagged | +Inquiry |
| ADIPOR1-358H | Recombinant Human ADK Protein, GST-tagged | +Inquiry |
| RFL-30392HF | Recombinant Full Length Human Adiponectin Receptor Protein 1(Adipor1) Protein, His&Myc-Tagged | +Inquiry |
| ADIPOR1-691HFL | Recombinant Full Length Human ADIPOR1 Protein, C-Flag-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ADIPOR1-026HKCL | Human ADIPOR1 Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADIPOR1 Products
Required fields are marked with *
My Review for All ADIPOR1 Products
Required fields are marked with *
