Recombinant Human ADK Protein, GST-tagged
Cat.No. : | ADIPOR1-358H |
Product Overview : | Human ADIPOR1 partial ORF ( NP_057083.2, 72 a.a. - 136 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a protein which acts as a receptor for adiponectin, a hormone secreted by adipocytes which regulates fatty acid catabolism and glucose levels. Binding of adiponectin to the encoded protein results in activation of an AMP-activated kinase signaling pathway which affects levels of fatty acid oxidation and insulin sensitivity. A pseudogene of this gene is located on chromosome 14. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Mar 2014] |
Molecular Mass : | 32.89 kDa |
AA Sequence : | QAHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ADIPOR1 adiponectin receptor 1 [ Homo sapiens ] |
Official Symbol | ADIPOR1 |
Synonyms | ADIPOR1; adiponectin receptor 1; adiponectin receptor protein 1; ACDCR1; PAQR1; progestin and adipoQ receptor family member I; CGI45; CGI-45; TESBP1A; FLJ25385; FLJ42464; |
Gene ID | 51094 |
mRNA Refseq | NM_015999 |
Protein Refseq | NP_057083 |
MIM | 607945 |
UniProt ID | Q96A54 |
◆ Recombinant Proteins | ||
ADIPOR1-234H | Recombinant Human ADIPOR1 Transmembrane protein | +Inquiry |
ADIPOR1-9426H | Recombinant Human ADIPOR1, GST-tagged | +Inquiry |
ADIPOR1-76R | Recombinant Rhesus Macaque ADIPOR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Adipor1-1541M | Recombinant Mouse Adipor1 Protein, Myc/DDK-tagged | +Inquiry |
ADIPOR1-557H | Recombinant Human ADIPOR1 protein, His & MBP-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ADIPOR1 Products
Required fields are marked with *
My Review for All ADIPOR1 Products
Required fields are marked with *
0
Inquiry Basket