Recombinant Human FUT9, His-tagged FUT9-26H

Recombinant Human FUT9, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human FUT9, His-tagged

Recombinant Human FUT9, His-tagged

FUT9 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : FUT9-26H
Product Overview : Recombinant Human α-(1,3)-Fucosyltransferase/FUT9 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Thr33-Asn359) of Human FUT9 fused with a polyhistidine tag at the C-terminus.
Description : α-(1,3)-Fucosyltransferase (FUT9) is a member of the glycosyltransferase 10 family. FUT9 is a single-pass type II membrane protein that is highly expressed in the forebrain and stomach. FUT9 transfers a fucose to lacto-N-neotetraose but not to either α2,3-sialyl lacto-N-neotetraose or lacto-N-tetraose. FUT9 can catalyze the last step in the biosynthesis of the Lewis-x antigen, which forms part of the Lewis blood group-related antigens. FUT9 can be upregulated by progesterone and ovary hormones.
Source : HEK293
Species : Human
Tag : His
AA Sequence : TNSWIFSPMESASSVLKMKNFFSTKTDYFNETTILVWVWPFGQTFDLTSCQAMFNIQGCHLTTDR SLYNKSHAVLIHHRDISWDLTNLPQQARPPFQKWIWMNLESPTHTPQKSGIEHLFNLTLTYRRDS DIQVPYGFLTVSTNPFVFEVPSKEKLVCWVVSNWNPEHARVKYYNELSKSIEIHTYGQAFGEYVN DKNLIPTISACKFYLSFENSIHKDYITEKLYNAFLAGSVPVVLGPSRENYENYIPADSFIHVEDY NSPSELAKYLKEVDKNNKLYLSYFNWRKDFTVNLPRFWESHACLACDHVKRHQEYKSVGNLEKWF WNLDHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy