Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

See All FUT9 Products

Specification Related Products

Cat.No. :	FUT9-26H
Product Overview :	Recombinant Human α-(1,3)-Fucosyltransferase/FUT9 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Thr33-Asn359) of Human FUT9 fused with a polyhistidine tag at the C-terminus.
Description :	α-(1,3)-Fucosyltransferase (FUT9) is a member of the glycosyltransferase 10 family. FUT9 is a single-pass type II membrane protein that is highly expressed in the forebrain and stomach. FUT9 transfers a fucose to lacto-N-neotetraose but not to either α2,3-sialyl lacto-N-neotetraose or lacto-N-tetraose. FUT9 can catalyze the last step in the biosynthesis of the Lewis-x antigen, which forms part of the Lewis blood group-related antigens. FUT9 can be upregulated by progesterone and ovary hormones.
Source :	HEK293
Species :	Human
Tag :	His
AA Sequence :	TNSWIFSPMESASSVLKMKNFFSTKTDYFNETTILVWVWPFGQTFDLTSCQAMFNIQGCHLTTDR SLYNKSHAVLIHHRDISWDLTNLPQQARPPFQKWIWMNLESPTHTPQKSGIEHLFNLTLTYRRDS DIQVPYGFLTVSTNPFVFEVPSKEKLVCWVVSNWNPEHARVKYYNELSKSIEIHTYGQAFGEYVN DKNLIPTISACKFYLSFENSIHKDYITEKLYNAFLAGSVPVVLGPSRENYENYIPADSFIHVEDY NSPSELAKYLKEVDKNNKLYLSYFNWRKDFTVNLPRFWESHACLACDHVKRHQEYKSVGNLEKWF WNLDHHHHHH
Endotoxin :	Less than 0.1 ng/μg (1 IEU/μg).
Purity :	Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.