"FUT9" Related Products

Expand
Expand

Recombinant Human FUT9, His-tagged

Cat.No.: FUT9-26H
Product Overview: Recombinant Human α-(1,3)-Fucosyltransferase/FUT9 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Thr33-Asn359) of Human FUT9 fused with a polyhistidine tag at the C-terminus.
Description: α-(1,3)-Fucosyltransferase (FUT9) is a member of the glycosyltransferase 10 family. FUT9 is a single-pass type II membrane protein that is highly expressed in the forebrain and stomach. FUT9 transfers a fucose to lacto-N-neotetraose but not to either α2,3-sialyl lacto-N-neotetraose or lacto-N-tetraose. FUT9 can catalyze the last step in the biosynthesis of the Lewis-x antigen, which forms part of the Lewis blood group-related antigens. FUT9 can be upregulated by progesterone and ovary hormones.
Source: HEK293
Species: Human
Tag: His
AA Sequence: TNSWIFSPMESASSVLKMKNFFSTKTDYFNETTILVWVWPFGQTFDLTSCQAMFNIQGCHLTTDR SLYNKSHAVLIHHRDISWDLTNLPQQARPPFQKWIWMNLESPTHTPQKSGIEHLFNLTLTYRRDS DIQVPYGFLTVSTNPFVFEVPSKEKLVCWVVSNWNPEHARVKYYNELSKSIEIHTYGQAFGEYVN DKNLIPTISACKFYLSFENSIHKDYITEKLYNAFLAGSVPVVLGPSRENYENYIPADSFIHVEDY NSPSELAKYLKEVDKNNKLYLSYFNWRKDFTVNLPRFWESHACLACDHVKRHQEYKSVGNLEKWF WNLDHHHHHH
Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.