Recombinant Human FUT9 Protein, GST-tagged
Cat.No. : | FUT9-4569H |
Product Overview : | Human FUT9 full-length ORF ( AAH36101.1, 1 a.a. - 359 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | FUT9 is one of several alpha-3-fucosyltransferases that can catalyze the last step in the biosynthesis of Lewis antigen, the addition of a fucose to precursor polysaccharides. FUT9 synthesizes the LeX oligosaccharide (CD15), which is expressed in organ buds progressing in mesenchyma during human embryogenesis.[supplied by OMIM |
Molecular Mass : | 68.4 kDa |
AA Sequence : | MTSTSKGILRPFLIVCIILGCFMACLLIYIKPTNSWIFSPMESASSVLKMKNFFSTKTDYFNETTILVWVWPFGQTFDLTSCQAMFNIQGCHLTTDRSLYNKSHAVLIHHRDISWDLTNLPQQARPPFQKWIWMNLESPTHTPQKSGIEHLFNLTLTYRRDSDIQVPYGFLTVSTNPFVFEVPSKEKLVCWVVSNWNPEHARVKYYNELSKSIEIHTYGQAFGEYVNDKNLIPTISACKFYLSFENSIHKDYITEKLYNAFLAGSVPVVLGPSRENYENYIPADSFIHVEDYNSPSELAKYLKEVDKNNKLYLSYFNWRKDFTVNLPRFWESHACLACDHVKRHQEYKSVGNLEKWFWN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FUT9 fucosyltransferase 9 (alpha (1,3) fucosyltransferase) [ Homo sapiens ] |
Official Symbol | FUT9 |
Synonyms | fucosyltransferase 9 (alpha (1,3) fucosyltransferase); 4020; Ensembl:ENSG00000172461; alpha-(1,3)-fucosyltransferase;fucT-IX;fucosyltransferase IX;galactoside 3-L-fucosyltransferase; 2.4.1.152; Fuc-TIX |
Gene ID | 10690 |
mRNA Refseq | NM_006581 |
Protein Refseq | NP_006572 |
MIM | 606865 |
UniProt ID | Q9Y231 |
◆ Recombinant Proteins | ||
Fut9-3291M | Recombinant Mouse Fut9, His-tagged | +Inquiry |
FUT9-1591R | Recombinant Rhesus Macaque FUT9 Protein, His (Fc)-Avi-tagged | +Inquiry |
FUT9-30H | Recombinant Human FUT9 Protein (AA 39-359), N-6×His/GFP tagged | +Inquiry |
FUT9-219H | Recombinant Human FUT9 Protein, Thr33-Asn359 | +Inquiry |
FUT9-26H | Recombinant Human FUT9, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FUT9-6111HCL | Recombinant Human FUT9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FUT9 Products
Required fields are marked with *
My Review for All FUT9 Products
Required fields are marked with *