Cat.No. :	FUT9-4569H
Product Overview :	Human FUT9 full-length ORF ( AAH36101.1, 1 a.a. - 359 a.a.) recombinant protein with GST-tag at N-terminal.
Description :	FUT9 is one of several alpha-3-fucosyltransferases that can catalyze the last step in the biosynthesis of Lewis antigen, the addition of a fucose to precursor polysaccharides. FUT9 synthesizes the LeX oligosaccharide (CD15), which is expressed in organ buds progressing in mesenchyma during human embryogenesis.[supplied by OMIM
Source :	Wheat Germ
Species :	Human
Tag :	GST
Molecular Mass :	68.4 kDa
AA Sequence :	MTSTSKGILRPFLIVCIILGCFMACLLIYIKPTNSWIFSPMESASSVLKMKNFFSTKTDYFNETTILVWVWPFGQTFDLTSCQAMFNIQGCHLTTDRSLYNKSHAVLIHHRDISWDLTNLPQQARPPFQKWIWMNLESPTHTPQKSGIEHLFNLTLTYRRDSDIQVPYGFLTVSTNPFVFEVPSKEKLVCWVVSNWNPEHARVKYYNELSKSIEIHTYGQAFGEYVNDKNLIPTISACKFYLSFENSIHKDYITEKLYNAFLAGSVPVVLGPSRENYENYIPADSFIHVEDYNSPSELAKYLKEVDKNNKLYLSYFNWRKDFTVNLPRFWESHACLACDHVKRHQEYKSVGNLEKWFWN
Applications :	Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array
Notes :	Best use within three months from the date of receipt of this protein.
Storage :	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Name :	FUT9 fucosyltransferase 9 (alpha (1,3) fucosyltransferase) [ Homo sapiens ]
Official Symbol :	FUT9
Synonyms :	fucosyltransferase 9 (alpha (1,3) fucosyltransferase); 4020; Ensembl:ENSG00000172461; alpha-(1,3)-fucosyltransferase;fucT-IX;fucosyltransferase IX;galactoside 3-L-fucosyltransferase; 2.4.1.152; Fuc-TIX
Gene ID :	10690
mRNA Refseq :	NM_006581
Protein Refseq :	NP_006572
MIM :	606865
UniProt ID :	Q9Y231

Online Inquiry