"CTSL" Related Products

Expand
Expand

Recombinant Human CTSL, His-tagged

Cat.No.: CTSL-54H
Product Overview: Recombinant Human Cathepsin L is produced by our mammalian expression system in human cells. The target protein is expressed with the full length sequence of Human Cathepsin L fused with a polyhistidine tag at the C-terminus.
Source: HEK293
Species: Human
Tag: His
Form: Supplied as a 0.2 μM filtered solution of 20mM HAc-NaAc, 150mM NaCl, pH 4.5
AA Sequence: TLTFDHSLEAQWTKWKAMHNRLYGMNEEGWRRAVWEKNVKMIELHNQEYREGKHSFTMAMNAFGD MTSEEFRQVMNGFQNRKPRKGKVFQEPLFYEAPRSVDWREKGYVTPVKNQGQCGSCWAFSATGAL EGQMFRKTGRLISLSEQNLVDCSGPQGNEGCNGGLMDYAFQYVQDNGGLDSEESYPYEATEESCK YNPKYSVANDTGFVDIPKQEKALMKAVATVGPISVAIDAGHESFLFYKEGIYFEPDCSSEDMDHG VLVVGYGFESTESDNNKYWLVKNSWGEEWGMGGYVKMAKDRRNHCGIASAASYPTVVDHHHHHH
Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage: Store at Please minimize freeze-thaw cycles.

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.