Recombinant Human SIGLEC6, His-tagged

Cat.No. : SIGLEC6-59H
Product Overview : Recombinant Human Sialic Acid-Binding Ig-Like Lectin 6/SIGLEC6 produced by transfected human cells is a secreted protein with sequence (Gln27-Val347) of Human siglec-6/CD327 fused with a polyhistidine tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 27-347 a.a.
Form : Lyophilized from a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.4
AA Sequence : QERRFQLEGPESLTVQEGLCVLVPCRLPTTLPASYYGYGYWFLEGADVPVATNDPDEEVQEETRG RFHLLWDPRRKNCSLSIRDARRRDNAAYFFRLKSKWMKYGYTSSKLSVRVMALTHRPNISIPGTL ESGHPSNLTCSVPWVCEQGTPPIFSWMSAAPTSLGPRTTQSSVLTITPRPQDHSTNLTCQVTFPG AGVTMERTIQLNVSSFKILQNTSSLPVLEGQALRLLCDADGNPPAHLSWFQGFPALNATPISNTG VLELPQVGSAEEGDFTCRAQHPLGSLQISLSLFVHWKPEGRAGGVDHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage : Lyophilized protein should be stored at Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at
Reconstitution : Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name SIGLEC6 sialic acid binding Ig-like lectin 6 [ Homo sapiens ]
Official Symbol SIGLEC6
Synonyms SIGLEC6; sialic acid binding Ig-like lectin 6; CD33L, CD33L1; sialic acid-binding Ig-like lectin 6; CD327; OB BP1; SIGLEC 6; CD33 antigen-like 1; obesity-binding protein 1; CD33L; OBBP1; CD33L1; CD33L2; CDW327;
Gene ID 946
mRNA Refseq NM_001177547
Protein Refseq NP_001171018
MIM 604405
UniProt ID O43699
Chromosome Location 19q13.3
Function sugar binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SIGLEC6 Products

Required fields are marked with *

My Review for All SIGLEC6 Products

Required fields are marked with *

0
cart-icon