Recombinant Human SIGLEC6, His-tagged SIGLEC6-59H

Recombinant Human SIGLEC6, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human SIGLEC6, His-tagged

Recombinant Human SIGLEC6, His-tagged

SIGLEC6 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : SIGLEC6-59H
Product Overview : Recombinant Human Sialic Acid-Binding Ig-Like Lectin 6/SIGLEC6 produced by transfected human cells is a secreted protein with sequence (Gln27-Val347) of Human siglec-6/CD327 fused with a polyhistidine tag at the C-terminus.
Source : HEK293
Species : Human
Tag : His
Form : Lyophilized from a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.4
AA Sequence : QERRFQLEGPESLTVQEGLCVLVPCRLPTTLPASYYGYGYWFLEGADVPVATNDPDEEVQEETRG RFHLLWDPRRKNCSLSIRDARRRDNAAYFFRLKSKWMKYGYTSSKLSVRVMALTHRPNISIPGTL ESGHPSNLTCSVPWVCEQGTPPIFSWMSAAPTSLGPRTTQSSVLTITPRPQDHSTNLTCQVTFPG AGVTMERTIQLNVSSFKILQNTSSLPVLEGQALRLLCDADGNPPAHLSWFQGFPALNATPISNTG VLELPQVGSAEEGDFTCRAQHPLGSLQISLSLFVHWKPEGRAGGVDHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage : Lyophilized protein should be stored at Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at
Reconstitution : Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name : SIGLEC6 sialic acid binding Ig-like lectin 6 [ Homo sapiens ]
Official Symbol : SIGLEC6
Synonyms : SIGLEC6; sialic acid binding Ig-like lectin 6; CD33L, CD33L1; sialic acid-binding Ig-like lectin 6; CD327; OB BP1; SIGLEC 6; CD33 antigen-like 1; obesity-binding protein 1; CD33L; OBBP1; CD33L1; CD33L2; CDW327;
Gene ID : 946
mRNA Refseq : NM_001177547
Protein Refseq : NP_001171018
MIM : 604405
UniProt ID : O43699
Chromosome Location : 19q13.3
Function : sugar binding;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy