"SIGLEC6" Related Products

Expand
Expand

Recombinant Human SIGLEC6, His-tagged

Cat.No.: SIGLEC6-59H
Product Overview: Recombinant Human Sialic Acid-Binding Ig-Like Lectin 6/SIGLEC6 produced by transfected human cells is a secreted protein with sequence (Gln27-Val347) of Human siglec-6/CD327 fused with a polyhistidine tag at the C-terminus.
Source: HEK293
Species: Human
Tag: His
Form: Lyophilized from a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.4
AA Sequence: QERRFQLEGPESLTVQEGLCVLVPCRLPTTLPASYYGYGYWFLEGADVPVATNDPDEEVQEETRG RFHLLWDPRRKNCSLSIRDARRRDNAAYFFRLKSKWMKYGYTSSKLSVRVMALTHRPNISIPGTL ESGHPSNLTCSVPWVCEQGTPPIFSWMSAAPTSLGPRTTQSSVLTITPRPQDHSTNLTCQVTFPG AGVTMERTIQLNVSSFKILQNTSSLPVLEGQALRLLCDADGNPPAHLSWFQGFPALNATPISNTG VLELPQVGSAEEGDFTCRAQHPLGSLQISLSLFVHWKPEGRAGGVDHHHHHH
Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage: Lyophilized protein should be stored at Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at
Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name: SIGLEC6 sialic acid binding Ig-like lectin 6 [ Homo sapiens ]
Official Symbol: SIGLEC6
Synonyms: SIGLEC6; sialic acid binding Ig-like lectin 6; CD33L, CD33L1; sialic acid-binding Ig-like lectin 6; CD327; OB BP1; SIGLEC 6; CD33 antigen-like 1; obesity-binding protein 1; CD33L; OBBP1; CD33L1; CD33L2; CDW327;
Gene ID: 946
mRNA Refseq: NM_001177547
Protein Refseq: NP_001171018
MIM: 604405
UniProt ID: O43699
Chromosome Location: 19q13.3
Function: sugar binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.